SitesBLAST
Comparing WP_011022629.1 NCBI__GCF_000007345.1:WP_011022629.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O58965 Phosphoglycerate kinase; EC 2.7.2.3 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
41% identity, 95% coverage: 13:403/412 of query aligns to 4:399/410 of O58965
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
37% identity, 96% coverage: 9:403/412 of query aligns to 1:394/398 of 1vpeA
- active site: R35 (≠ K44), K196 (= K208), G353 (= G362), G376 (= G385)
- binding phosphoaminophosphonic acid-adenylate ester: G194 (= G206), A195 (≠ T207), K196 (= K208), K200 (≠ I212), G218 (= G232), A219 (≠ V233), N316 (≠ H329), P318 (= P331), G320 (= G333), V321 (≠ I334), E323 (= E336), G352 (= G361), G353 (= G362), D354 (≠ H363), S355 (≠ T364)
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
37% identity, 96% coverage: 9:404/412 of query aligns to 2:396/654 of P36204
- R36 (≠ K44) binding
- R118 (= R122) binding
- R151 (= R162) binding
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
36% identity, 95% coverage: 12:404/412 of query aligns to 5:393/394 of 1phpA
- active site: R36 (≠ K44), K197 (= K208), G351 (= G362), G374 (= G385)
- binding adenosine-5'-diphosphate: G195 (= G206), K201 (≠ I212), G219 (= G232), G220 (≠ V233), L237 (≠ F253), N316 (≠ H329), P318 (= P331), G320 (= G333), V321 (≠ I334), E323 (= E336), G350 (= G361), D352 (≠ H363), S353 (≠ T364)
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
36% identity, 95% coverage: 12:404/412 of query aligns to 5:393/394 of P18912
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
34% identity, 95% coverage: 12:404/412 of query aligns to 5:393/394 of P40924
- S183 (≠ K194) modified: Phosphoserine
- T299 (= T312) modified: Phosphothreonine
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
32% identity, 97% coverage: 10:408/412 of query aligns to 3:392/392 of 4feyA
- active site: R36 (≠ K44), K193 (= K208), G346 (= G362), G369 (= G385)
- binding adenosine-5'-diphosphate: G191 (= G206), S192 (≠ T207), K197 (≠ I212), G215 (= G232), G316 (= G333), V317 (≠ I334), E319 (= E336), D347 (≠ H363)
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
32% identity, 96% coverage: 10:406/412 of query aligns to 2:388/389 of 4ng4B
- active site: R35 (≠ K44), K191 (= K208), G344 (= G362), G367 (= G385)
- binding adenosine-5'-diphosphate: G189 (= G206), K195 (≠ I212), G213 (= G232), I286 (= I305), N310 (≠ H329), G311 (= G330), P312 (= P331), V315 (≠ I334), E317 (= E336), G343 (= G361), D345 (≠ H363), T346 (= T364)
- binding magnesium ion: D288 (= D307), G314 (= G333), F321 (= F340), S322 (≠ R341), T325 (= T344)
3zlbA Crystal structure of phosphoglycerate kinase from streptococcus pneumoniae (see paper)
34% identity, 95% coverage: 11:402/412 of query aligns to 4:395/398 of 3zlbA
- active site: R36 (≠ K44), K204 (= K208), G355 (= G362), G378 (= G385)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G206), S203 (≠ T207), G226 (= G232), G227 (≠ V233), N320 (≠ H329), P322 (= P331), G324 (= G333), V325 (≠ I334), E327 (= E336), G354 (= G361), G355 (= G362), D356 (≠ H363), S357 (≠ T364)
- binding magnesium ion: D8 (= D15)
Sites not aligning to the query:
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
32% identity, 95% coverage: 12:402/412 of query aligns to 8:416/440 of P07378
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
32% identity, 95% coverage: 12:402/412 of query aligns to 4:412/415 of 16pkA
- active site: R35 (≠ K44), K215 (= K208), G372 (= G362), G395 (= G385)
- binding 1,1,5,5-tetrafluorophosphopentylphosphonic acid adenylate ester: G213 (= G206), A214 (≠ T207), K219 (≠ I212), A238 (≠ V233), Y241 (≠ T236), L311 (≠ A306), P336 (= P331), G338 (= G333), V339 (≠ I334), E341 (= E336), G393 (= G383), G394 (= G384), G395 (= G385)
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
32% identity, 95% coverage: 12:402/412 of query aligns to 4:412/415 of 13pkA
- active site: R35 (≠ K44), K215 (= K208), G372 (= G362), G395 (= G385)
- binding adenosine-5'-diphosphate: G213 (= G206), A214 (≠ T207), K219 (≠ I212), L311 (≠ A306), P336 (= P331), G338 (= G333), V339 (≠ I334), E341 (= E336), G371 (= G361), D373 (≠ H363), S374 (≠ T364)
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
34% identity, 96% coverage: 11:404/412 of query aligns to 3:412/413 of 2paaA
- active site: R35 (≠ K44), K212 (= K208), G370 (= G362), G393 (= G385)
- binding adenosine-5'-triphosphate: G210 (= G206), A211 (≠ T207), K216 (≠ I212), G235 (≠ V233), L253 (≠ V246), G309 (vs. gap), L310 (vs. gap), G334 (= G330), G337 (= G333), V338 (≠ I334), E340 (= E336), D371 (≠ H363)
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
32% identity, 96% coverage: 9:404/412 of query aligns to 3:406/407 of 4axxA
- active site: R37 (≠ K44), K206 (= K208), G364 (= G362), G387 (= G385)
- binding adenosine-5'-diphosphate: G204 (= G206), A205 (≠ T207), K210 (≠ I212), G228 (= G232), G229 (≠ V233), N327 (≠ H329), P329 (= P331), G331 (= G333), V332 (≠ I334), E334 (= E336), G363 (= G361), G364 (= G362), D365 (≠ H363), T366 (= T364)
- binding beryllium trifluoride ion: K206 (= K208), K210 (≠ I212), G363 (= G361)
2x15A The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp and 1,3- bisphosphoglycerate
32% identity, 96% coverage: 9:404/412 of query aligns to 3:407/408 of 2x15A
- active site: R37 (≠ K44), K207 (= K208), G365 (= G362), G388 (= G385)
- binding adenosine-5'-diphosphate: G205 (= G206), A206 (≠ T207), K207 (= K208), K211 (≠ I212), G229 (= G232), G230 (≠ V233), N328 (≠ H329), P330 (= P331), G332 (= G333), V333 (≠ I334), E335 (= E336), G364 (= G361), G365 (= G362), D366 (≠ H363), T367 (= T364)
- binding adenosine-5'-triphosphate: G205 (= G206), A206 (≠ T207), K207 (= K208), K211 (≠ I212), G229 (= G232), G230 (≠ V233), N328 (≠ H329), G332 (= G333), V333 (≠ I334), E335 (= E336), G364 (= G361), G365 (= G362), D366 (≠ H363), T367 (= T364), G387 (= G384), G388 (= G385)
- binding 1,3-bisphosphoglyceric acid: D22 (= D28), N24 (= N30), R37 (≠ K44), H61 (= H65), R64 (= R68), R121 (= R122), R162 (= R162), K207 (= K208), K211 (≠ I212), G364 (= G361), G387 (= G384), G388 (= G385)
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
34% identity, 96% coverage: 11:404/412 of query aligns to 7:416/417 of P09041
- K220 (≠ I212) binding
- G313 (vs. gap) binding
- E344 (= E336) binding
- GGDT 373:376 (≠ GGHT 361:364) binding
P00558 Phosphoglycerate kinase 1; Cell migration-inducing gene 10 protein; Primer recognition protein 2; PRP 2; EC 2.7.2.3 from Homo sapiens (Human) (see 16 papers)
32% identity, 96% coverage: 9:404/412 of query aligns to 5:416/417 of P00558
- DFN 24:26 (= DFN 28:30) binding
- R39 (≠ K44) binding
- HLGR 63:66 (≠ HQGR 65:68) binding
- L88 (= L87) to P: in PGK1D; with congenital non-spherocytic anemia; variant Matsue; dbSNP:rs137852531
- K97 (≠ D96) modified: N6-(2-hydroxyisobutyryl)lysine; alternate
- R123 (= R122) binding
- K131 (vs. gap) modified: N6-malonyllysine; alternate
- G158 (≠ F149) to V: in PGK1D; with chronic hemolytic anemia; variant Shizuoka; dbSNP:rs137852532
- D164 (= D155) to V: in PGK1D; with chronic hemolytic anemia and intellectual disability; variant Amiens; dbSNP:rs137852538
- R171 (= R162) binding
- K191 (≠ D183) natural variant: Missing (in PGK1D; with chronic hemolytic anemia; variant Alabama)
- R206 (≠ H198) to P: in PGK1D; with chronic hemolytic anemia; variant Uppsala; dbSNP:rs137852529
- K216 (= K208) modified: N6-(2-hydroxyisobutyryl)lysine
- K220 (≠ I212) binding ; modified: N6-(2-hydroxyisobutyryl)lysine
- E252 (≠ S264) to A: in PGK1D; with chronic hemolytic anemia; variant Antwerp
- V266 (≠ I278) to M: in PGK1D; with chronic non-spherocytic hemolytic anemia; variant Tokyo; dbSNP:rs431905501
- D268 (= D282) to N: in Munchen; 21% of activity; dbSNP:rs137852528
- D285 (= D297) to V: in PGK1D; with chronic hemolytic anemia; variant Herlev; 50% of activity; dbSNP:rs137852535
- G313 (vs. gap) binding
- D315 (= D307) to N: in PGK1D; with rhabdomyolysis; variant Creteil
- C316 (≠ I308) to R: in PGK1D; with chronic hemolytic anemia; variant Michigan; dbSNP:rs137852533
- K323 (≠ D315) modified: N6-(2-hydroxyisobutyryl)lysine
- E344 (= E336) binding
- T352 (= T344) to N: in dbSNP:rs137852530
- GGDT 373:376 (≠ GGHT 361:364) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2y3iA The structure of the fully closed conformation of human pgk in complex with l-adp, 3pg and the tsa aluminium tetrafluoride (see paper)
32% identity, 96% coverage: 9:404/412 of query aligns to 3:414/414 of 2y3iA
- active site: R37 (≠ K44), K214 (= K208), G372 (= G362), G395 (= G385)
- binding tetrafluoroaluminate ion: K214 (= K208), G371 (= G361), G372 (= G362), G394 (= G384)
- binding l-adenosine-5'-diphosphate: G212 (= G206), A213 (≠ T207), F290 (vs. gap), N335 (≠ H329), G339 (= G333), V340 (≠ I334), E342 (= E336), G371 (= G361), G372 (= G362), D373 (≠ H363), T374 (= T364)
5m1rA X-ray structure of human g166d pgk-1 mutant (see paper)
32% identity, 96% coverage: 9:404/412 of query aligns to 4:415/416 of 5m1rA
- active site: R38 (≠ K44), K215 (= K208), G373 (= G362), G396 (= G385)
- binding adenosine-5'-diphosphate: G213 (= G206), A214 (≠ T207), K219 (≠ I212), G237 (= G232), G238 (≠ V233), L256 (= L269), G340 (= G333), V341 (≠ I334), E343 (= E336), D374 (≠ H363), T375 (= T364)
- binding magnesium ion: R150 (= R143), A151 (vs. gap), G372 (= G361), T375 (= T364)
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
32% identity, 96% coverage: 9:404/412 of query aligns to 3:404/405 of 2wzdA
- active site: R37 (≠ K44), K204 (= K208), G362 (= G362), G385 (= G385)
- binding adenosine-5'-diphosphate: G202 (= G206), A203 (≠ T207), K204 (= K208), G226 (= G232), G227 (≠ V233), N325 (≠ H329), P327 (= P331), G329 (= G333), V330 (≠ I334), E332 (= E336), G361 (= G361), D363 (≠ H363), T364 (= T364)
- binding aluminum fluoride: R37 (≠ K44), K204 (= K208), G361 (= G361), G362 (= G362), G384 (= G384)
Query Sequence
>WP_011022629.1 NCBI__GCF_000007345.1:WP_011022629.1
MSQKTAGKDYLTMDDVELDNKRILLRVDFNSPMDANGNILDDRKIKSHLYTLRSLENSRV
VMMSHQGRPGDKDYTTLEAHAKLATELLGRKVTYEDDIFSACARNAIKSLEKGDILLLEN
TRFYAEENMNRAPEEQARTQMVRKLYPLFDVFINDAFSVSHRSQCSVVGFTEVLPSVAGI
LMDREITGLDKGLKCHEHPAVFALGGTKAKDIVKVISDILKRGGADRILTTGVVATVFMM
AIGIEVGEVNRKFIEDHKYLDQVSIASRLLKEYSGKIIVPKDIALNNDGKREEVKVDKIK
GDLPIADIGPETISDYSKFLKEAKLSVFHGPAGIFELESFRLGTEELLKAAAQSNYSIAG
GGHTLAAIDQLGLESKYSHLSMGGGASITYLSGEHMPGIEALKNYASRCCKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory