Comparing WP_011022656.1 NCBI__GCF_000007345.1:WP_011022656.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7d54A Crstal structure msgatase with gln (see paper)
28% identity, 79% coverage: 40:227/238 of query aligns to 53:234/242 of 7d54A
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
28% identity, 86% coverage: 18:221/238 of query aligns to 47:240/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
27% identity, 86% coverage: 18:221/238 of query aligns to 25:215/658 of 2vxoB
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
29% identity, 61% coverage: 48:191/238 of query aligns to 50:187/490 of 5tw7F
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
34% identity, 55% coverage: 48:179/238 of query aligns to 46:167/475 of 2ywcA
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
30% identity, 56% coverage: 64:196/238 of query aligns to 53:179/183 of 7yc6A
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
29% identity, 58% coverage: 43:180/238 of query aligns to 230:357/2224 of P05990
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
33% identity, 41% coverage: 81:178/238 of query aligns to 246:338/2225 of P08955
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
28% identity, 48% coverage: 78:191/238 of query aligns to 75:195/501 of 1gpmA
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
29% identity, 58% coverage: 42:178/238 of query aligns to 45:173/673 of 8hx8A
Sites not aligning to the query:
>WP_011022656.1 NCBI__GCF_000007345.1:WP_011022656.1
MKLQVLQHSALNTLGTIEEYAKTRSYPLESTRFYETKNPPSLDSFDLLIIMGGPMGIYDY
AENPWLRDEKSFIKQAIDAGKPVLGICLGAQLLANILGARIYENGHREMGWFPVKAVRKE
ENKPEFLKGLPEEITVFHWHSRTFDLPEGAVHLFRSEGCKNQGFIYGGRVVALQFHPEVH
EERVESMIRRFGGESGNGPFTQRKEEMVGQEKYLVETKKFMFAVLDKFEKIAGKGRLE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory