Comparing WP_011024466.1 NCBI__GCF_000007345.1:WP_011024466.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05194 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 87% coverage: 32:241/242 of query aligns to 39:249/252 of P05194
1l9wA Crystal structure of 3-dehydroquinase from salmonella typhi complexed with reaction product (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 1l9wA
8b2cAAA 3-dehydroquinate dehydratase (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 8b2cAAA
8b2bAAA 3-dehydroquinate dehydratase (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 8b2bAAA
6sfeA Crystal structure of dhq1 from salmonella typhi covalently modified by compound 7 (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 6sfeA
6h5jA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 4
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 6h5jA
6h5gA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 3
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 6h5gA
6h5cA Crystal structure of dhq1 from salmonella typhi covalently modified by ligand 1
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 6h5cA
4cnpA Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-epiquinic acid derivative
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of 4cnpA
P24670 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Salmonella typhi (see 3 papers)
35% identity, 87% coverage: 32:242/242 of query aligns to 39:250/252 of P24670
Sites not aligning to the query:
4clmB Structure of salmonella typhi type i dehydroquinase irreversibly inhibited with a 1,3,4-trihydroxyciclohexane-1-carboxylic acid derivative (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 38:249/251 of 4clmB
4uioA Structure of the salmonella typhi type i dehydroquinase covalently inhibited by a 3-dehydroquinic acid derivative (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 37:248/250 of 4uioA
4cnoA Structure of the salmonella typhi type i dehydroquinase inhibited by a 3-dehydroquinic acid derivative (see paper)
35% identity, 87% coverage: 32:242/242 of query aligns to 38:245/247 of 4cnoA
Sites not aligning to the query:
Q9SQT8 Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic; DHQ-SDH protein; DHQase-SORase; Protein EMBRYO DEFECTIVE 3004; EC 4.2.1.10; EC 1.1.1.25 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 93% coverage: 3:228/242 of query aligns to 83:304/603 of Q9SQT8
Sites not aligning to the query:
6bmqA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase (t381g mutant) in complex with tartrate and shikimate (see paper)
35% identity, 89% coverage: 13:228/242 of query aligns to 9:215/498 of 6bmqA
Sites not aligning to the query:
2gptA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase in complex with tartrate and shikimate (see paper)
35% identity, 89% coverage: 13:228/242 of query aligns to 9:215/498 of 2gptA
Sites not aligning to the query:
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
35% identity, 89% coverage: 13:228/242 of query aligns to 9:215/501 of 2o7qA
Sites not aligning to the query:
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
35% identity, 89% coverage: 13:228/242 of query aligns to 9:215/500 of 2o7sA
Sites not aligning to the query:
Q186A6 3-dehydroquinate dehydratase; 3-dehydroquinase; Type I DHQase; Type I dehydroquinase; DHQ1; EC 4.2.1.10 from Clostridioides difficile (strain 630) (Peptoclostridium difficile) (see paper)
33% identity, 90% coverage: 24:241/242 of query aligns to 32:250/255 of Q186A6
4h3dB 1.95 angstrom crystal structure of of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent modified comenic acid.
33% identity, 90% coverage: 24:241/242 of query aligns to 32:250/254 of 4h3dB
>WP_011024466.1 NCBI__GCF_000007345.1:WP_011024466.1
MTQIGPFDLEKKAAVVAVILEKPLETSKKAAEKGADILEVRLDLLGIRNPESAAKIIREI
KSETGLPVLVTNRSVAEGGKWEGKEVDRTELLVALLSLKDGPDAVDIELSASREDRDKVI
KAAKAHGKTVIISSHDFSKTPSPQEMTATLAEMFLAEADIAKIAVMPGSMEDVLNLLKVT
LEFKNTGKTVCTIAMGKPGKHTRVVAPLYGSVLTYASIESNAVAAPGQLPVDEVKKIMEM
LK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory