SitesBLAST
Comparing WP_011031991.1 NCBI__GCF_000007065.1:WP_011031991.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P59846 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
46% identity, 97% coverage: 4:387/394 of query aligns to 2:389/400 of P59846
- 6:14 (vs. 8:16, 100% identical) binding
- A33 (≠ V36) binding
- G114 (= G116) binding
1j20A Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with product (see paper)
46% identity, 97% coverage: 4:387/394 of query aligns to 2:380/386 of 1j20A
- active site: D12 (= D14), R92 (= R94), D121 (= D123), S168 (= S172)
- binding adenosine monophosphate: A6 (= A8), T13 (= T15), A33 (≠ V36), R92 (= R94), H113 (= H115), G114 (= G116), F125 (= F127)
- binding argininosuccinate: Y84 (vs. gap), T88 (= T90), A115 (≠ C117), T116 (= T118), G119 (= G121), N120 (= N122), D121 (= D123), R124 (= R126), S177 (= S181), E179 (= E183), E253 (= E257), Y265 (= Y269)
1j1zA Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with substrate (see paper)
46% identity, 97% coverage: 4:387/394 of query aligns to 2:380/386 of 1j1zA
- active site: D12 (= D14), R92 (= R94), D121 (= D123), S168 (= S172)
- binding aspartic acid: A115 (≠ C117), T116 (= T118), G119 (= G121), N120 (= N122), D121 (= D123)
- binding adenosine-5'-triphosphate: A6 (= A8), T13 (= T15), A33 (≠ V36), R92 (= R94), I95 (= I97), H113 (= H115), G114 (= G116), F125 (= F127)
- binding citrulline: Y84 (vs. gap), T88 (= T90), R124 (= R126), S168 (= S172), M169 (≠ V173), S177 (= S181), E179 (= E183), E253 (= E257), Y265 (= Y269)
4xfjB Crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine
40% identity, 98% coverage: 3:387/394 of query aligns to 2:390/397 of 4xfjB
- active site: D13 (= D14), R94 (= R94), D123 (= D123), S174 (= S172)
- binding phosphoaminophosphonic acid-adenylate ester: A7 (= A8), Y8 (= Y9), S9 (= S10), T14 (= T15), I34 (≠ V36), G116 (= G116), C117 (= C117), F127 (= F127)
- binding arginine: Y86 (= Y86), S90 (≠ T90), R126 (= R126), A183 (≠ S181), E185 (= E183), E259 (= E257), E269 (= E267), Y271 (= Y269)
7k5zA Crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1 in complex with anppnp and a substrate analogue arginine
43% identity, 99% coverage: 1:391/394 of query aligns to 2:383/390 of 7k5zA
- active site: D15 (= D14), R95 (= R94), D124 (= D123), S176 (= S172)
- binding phosphoaminophosphonic acid-adenylate ester: A9 (= A8), Y10 (= Y9), S11 (= S10), C37 (≠ V36), G117 (= G116), F128 (= F127)
- binding arginine: Y88 (= Y86), T92 (= T90), D124 (= D123), R127 (= R126), S185 (= S181), E187 (= E183), E261 (= E257), Y273 (= Y269)
1kh3A Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with inhibitor (see paper)
44% identity, 97% coverage: 4:387/394 of query aligns to 2:374/380 of 1kh3A
- active site: D12 (= D14), R92 (= R94), D121 (= D123), S168 (= S172)
- binding phosphoaminophosphonic acid-adenylate ester: A6 (= A8), T13 (= T15), T32 (≠ S35), A33 (≠ V36), H113 (= H115), G114 (= G116), F125 (= F127), S168 (= S172), M169 (≠ V173)
- binding arginine: Y84 (vs. gap), T88 (= T90), R124 (= R126), S168 (= S172), M169 (≠ V173), D170 (= D174), S177 (= S181), E179 (= E183), E253 (= E257), Y265 (= Y269)
- binding aspartic acid: A115 (≠ C117), T116 (= T118), G119 (= G121), N120 (= N122), D121 (= D123)
P00966 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Homo sapiens (Human) (see 16 papers)
40% identity, 99% coverage: 5:394/394 of query aligns to 7:408/412 of P00966
- V64 (≠ A64) to I: in CTLN1; uncertain significance; dbSNP:rs556297791
- Y87 (= Y86) binding
- T91 (= T90) to P: in CTLN1; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs769018733
- S92 (= S91) binding
- R95 (= R94) to S: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity
- P96 (= P95) to H: in CTLN1; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; to L: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; loss of argininosuccinate synthase activity; to S: in CTLN1; no effect on thermal stability; decreased argininosuccinate synthase activity
- G117 (= G116) to S: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs770944877
- A118 (≠ C117) to T: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs775305020
- T119 (= T118) binding ; to I: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity
- N123 (= N122) binding ; binding
- D124 (= D123) binding ; to N: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs936192871
- R127 (= R126) binding ; to L: increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs201623252; to Q: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs201623252; to W: in CTLN1; severe clinical course; loss of argininosuccinate synthase activity; dbSNP:rs771794639
- R157 (vs. gap) to C: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs770585183; to H: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908637
- K165 (= K157) modified: N6-acetyllysine; by CLOCK; mutation K->Q,R: Significant loss of acetylation but no decrease in enzyme activity; when associated with Q-176 or R-176.
- K176 (≠ S168) modified: N6-acetyllysine; by CLOCK; mutation K->Q,R: Significant loss of acetylation but no decrease in enzyme activity; when associated with Q-165 or R-165.
- W179 (= W171) to R: in CTLN1; mild; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908646
- S180 (= S172) binding ; to I: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs121908638; to N: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908638
- S189 (= S181) binding
- E191 (= E183) to Q: in CTLN1; loss of argininosuccinate synthase activity
- A192 (≠ G184) to V: in CTLN1; decreased protein abundance
- V263 (= V250) to M: in CTLN1; mild clinical course; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs192838388
- R265 (= R252) to C: in CTLN1; severe clinical course; loss of argininosuccinate synthase activity; dbSNP:rs148918985
- E270 (= E257) binding ; to Q: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs775163147
- R272 (= R259) to C: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs762387914; to H: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs768215008; to L: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs768215008
- G280 (≠ E267) to R: in CTLN1; loss of argininosuccinate synthase activity
- Y282 (= Y269) binding
- T284 (≠ H271) to I: in CTLN1; mild clinical course; dbSNP:rs886039853
- M302 (≠ L289) to V: in CTLN1; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity
- R304 (= R291) to W: in CTLN1; decreased protein abundance; dbSNP:rs121908642
- G324 (= G311) to S: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908639
- G347 (= G334) to R: in CTLN1; severe clinical course
- Y359 (≠ T346) to D: in CTLN1; mild clinical course
- G362 (≠ A349) to V: in CTLN1; mild; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908647
- G390 (= G376) to R: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908641
2nz2A Crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline (see paper)
40% identity, 98% coverage: 5:391/394 of query aligns to 4:400/402 of 2nz2A
- active site: D13 (= D14), R92 (= R94), D121 (= D123), S176 (= S172)
- binding aspartic acid: A115 (≠ C117), T116 (= T118), G119 (= G121), N120 (= N122), D121 (= D123)
- binding citrulline: Y84 (= Y86), T88 (= T90), N120 (= N122), R124 (= R126), D178 (= D174), S185 (= S181), E187 (= E183), E266 (= E257), Y278 (= Y269)
6e5yA 1.50 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis in complex with amp.
26% identity, 92% coverage: 3:365/394 of query aligns to 11:389/438 of 6e5yA
5us8A 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
26% identity, 92% coverage: 3:365/394 of query aligns to 15:393/445 of 5us8A
P0A6E4 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Escherichia coli (strain K12) (see 4 papers)
24% identity, 92% coverage: 3:365/394 of query aligns to 12:390/447 of P0A6E4
- 17:25 (vs. 8:16, 89% identical) binding
- A43 (≠ V36) binding
- Y99 (= Y86) binding
- G129 (= G116) binding
- T131 (= T118) binding ; binding
- N135 (= N122) binding ; binding
- D136 (= D123) binding ; binding
- R139 (= R126) binding
- S192 (= S172) binding
- D194 (= D174) binding
- T201 (≠ S181) binding
- E203 (= E183) binding
- E280 (= E257) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kp3A Crystal structure of e. Coli argininosuccinate synthetase in complex with atp and citrulline (see paper)
24% identity, 92% coverage: 3:364/394 of query aligns to 11:388/439 of 1kp3A
- active site: D22 (= D14), R106 (= R94), D135 (= D123), S191 (= S172)
- binding adenosine-5'-triphosphate: A16 (= A8), S18 (= S10), G20 (= G12), D22 (= D14), T23 (= T15), T41 (≠ S35), A42 (≠ V36), D127 (≠ H115), G128 (= G116), S129 (≠ C117), F139 (= F127), D193 (= D174)
- binding citrulline: Y98 (= Y86), T102 (= T90), P103 (≠ S91), T130 (= T118), G133 (= G121), N134 (= N122), D135 (= D123), R138 (= R126), D193 (= D174), T200 (≠ S181), E202 (= E183), E202 (= E183), E279 (= E257), S287 (≠ A265), Y291 (= Y269)
1k97A Crystal structure of e. Coli argininosuccinate synthetase in complex with aspartate and citrulline (see paper)
24% identity, 91% coverage: 3:362/394 of query aligns to 11:386/432 of 1k97A
- active site: D22 (= D14), R106 (= R94), D135 (= D123), S191 (= S172)
- binding aspartic acid: S129 (≠ C117), T130 (= T118), G133 (= G121), N134 (= N122), D135 (= D123)
- binding citrulline: Y98 (= Y86), T102 (= T90), P103 (≠ S91), R138 (= R126), S191 (= S172), T192 (≠ V173), D193 (= D174), T200 (≠ S181), E202 (= E183), E279 (= E257), Y291 (= Y269), Y331 (= Y309)
Query Sequence
>WP_011031991.1 NCBI__GCF_000007065.1:WP_011031991.1
MVKKVALAYSGGLDTSVCIPILKEKYGYDEVITISVDVGQPEEEIRKADAKAQKISNKHY
TIDAKEEFVRDYIFPLIKANGNYEGYVMGTSVARPLIAKKVVEAAKKEGAIALAHGCTGK
GNDQLRFEAVFRQTDMDVIAPMREMNLTREWEINYAKEHGIPVEATKSKPWSVDENIWSR
SIEGGRLEDPSFVPPEEIFEWTKSAEDAPNEPRIVDIDFEAGVPVAIDGEKLGGYALVKK
MNEIAGENGVGRTDMIEDRVLGLKARENYEHPAATVLLAAHADLEKLVLTRGELKFKKIV
EEQWSEMAYAGLVDDPLFADLNAFIDKSQERVTGTVKVKLYKGALTILARSSPNALYSED
LVSFDSQTIDQKDAEGFAKYHGFQARMYRKVVGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory