SitesBLAST
Comparing WP_011032099.1 NCBI__GCF_000007065.1:WP_011032099.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
55% identity, 99% coverage: 3:301/302 of query aligns to 8:310/315 of Q51742
- W22 (≠ Y17) mutation to A: Decreased heat stability.
- E26 (= E21) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ D25) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ K29) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y219) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ Q232) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E269) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
51% identity, 99% coverage: 3:302/302 of query aligns to 12:310/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
51% identity, 99% coverage: 3:302/302 of query aligns to 8:306/307 of 4nf2A
- active site: R55 (= R54), T56 (= T55), R83 (= R82), R104 (= R103), H131 (= H130), Q134 (= Q133), D226 (= D221), C265 (= C261), R293 (= R289)
- binding phosphoric acid mono(formamide)ester: S53 (= S52), T54 (= T53), R55 (= R54), T56 (= T55), R104 (= R103), H131 (= H130), Q134 (= Q133), C265 (= C261), L266 (= L262), R293 (= R289)
- binding norvaline: L126 (= L125), N162 (= N161), D226 (= D221), S230 (= S225), M231 (= M226)
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
47% identity, 99% coverage: 3:301/302 of query aligns to 2:302/304 of 8qeuA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
46% identity, 99% coverage: 3:301/302 of query aligns to 2:295/297 of 8qevA
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 100% coverage: 1:301/302 of query aligns to 1:304/307 of P9WIT9
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7nouA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D221), C265 (= C261), R293 (= R289)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I47), T52 (= T53), R53 (= R54), R53 (= R54), F56 (≠ V57), F56 (≠ V57), L79 (≠ V80), D82 (≠ G83), E83 (= E84), V91 (≠ T92), Y95 (= Y96), L266 (= L262), R293 (= R289)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7nnyA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D221), C265 (= C261), R293 (= R289)
- binding 1-naphthol: T52 (= T53), R53 (= R54), F56 (≠ V57), E83 (= E84), V91 (≠ T92), Y95 (= Y96)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7nnwA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D221), C265 (= C261), R293 (= R289)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I47), T52 (= T53), R53 (= R54), F56 (≠ V57), L79 (≠ V80), L92 (= L93), Y95 (= Y96)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
46% identity, 99% coverage: 3:301/302 of query aligns to 4:305/308 of 7nnvA
- active site: R102 (= R103), H129 (= H130), Q132 (= Q133), D225 (= D221), C265 (= C261), R293 (= R289)
- binding phosphoric acid mono(formamide)ester: S51 (= S52), T52 (= T53), R53 (= R54), T54 (= T55), R102 (= R103), H129 (= H130), C265 (= C261), L266 (= L262), R293 (= R289)
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
46% identity, 99% coverage: 3:301/302 of query aligns to 3:304/307 of 2i6uA
- active site: R52 (= R54), T53 (= T55), R80 (= R82), R101 (= R103), H128 (= H130), Q131 (= Q133), D224 (= D221), C264 (= C261), R292 (= R289)
- binding phosphoric acid mono(formamide)ester: S50 (= S52), T51 (= T53), R52 (= R54), T53 (= T55), R101 (= R103), C264 (= C261), L265 (= L262), R292 (= R289)
- binding norvaline: L123 (= L125), N160 (= N161), D224 (= D221), S228 (= S225), M229 (= M226)
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
42% identity, 99% coverage: 3:301/302 of query aligns to 40:342/354 of P00481
- R92 (= R54) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C261) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
45% identity, 99% coverage: 3:301/302 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R103), H123 (= H130), Q126 (= Q133), D219 (= D221), C259 (= C261), R287 (= R289)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R54), F56 (≠ V57), E77 (= E84), V85 (≠ T92), Y89 (= Y96), L260 (= L262), A284 (= A286), R287 (= R289)
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
45% identity, 99% coverage: 3:301/302 of query aligns to 4:302/305 of 7np0A
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
42% identity, 99% coverage: 3:301/302 of query aligns to 40:342/354 of P00480
- R40 (= R3) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L6) to F: in dbSNP:rs72554309
- K46 (≠ T9) to R: in dbSNP:rs1800321
- Y55 (≠ E18) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L26) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K50) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 52:55) binding
- G100 (≠ A62) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M63) to L: in dbSNP:rs1133135
- L111 (= L73) to P: in dbSNP:rs1800324
- T125 (≠ E87) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D88) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (= R91) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (= A102) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R103) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H130) binding
- Q171 (= Q133) binding
- I172 (= I134) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ F138) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TI 140:141) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ K145) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G150) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G157) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D158) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ C163) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ G169) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (= A171) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (= M175) to K: in OTCD; late onset
- H214 (≠ E176) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P182) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P187) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ F202) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T220) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V222) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W223) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G227) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (≠ D228) to R: in dbSNP:rs1800328
- E272 (≠ A230) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R235) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H260) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C261) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 261:262) binding
- E309 (≠ L268) natural variant: Missing (in OTCD; late onset)
- R330 (= R289) binding
- T333 (≠ A292) natural variant: T -> A
- S340 (≠ K299) to P: in OTCD; late onset; dbSNP:rs72558489
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 39 G → C: in OTCD; late onset; dbSNP:rs72554306
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
42% identity, 99% coverage: 3:301/302 of query aligns to 7:309/321 of 1othA
- active site: R59 (= R54), T60 (= T55), V87 (≠ R82), R108 (= R103), H135 (= H130), Q138 (= Q133), D230 (= D221), C270 (= C261), R297 (= R289)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S52), T58 (= T53), R59 (= R54), T60 (= T55), R108 (= R103), L130 (= L125), H135 (= H130), N166 (= N161), D230 (= D221), S234 (= S225), M235 (= M226), C270 (= C261), L271 (= L262), R297 (= R289)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
42% identity, 99% coverage: 3:301/302 of query aligns to 7:309/321 of 1c9yA
- active site: R59 (= R54), T60 (= T55), V87 (≠ R82), R108 (= R103), H135 (= H130), Q138 (= Q133), D230 (= D221), C270 (= C261), R297 (= R289)
- binding phosphoric acid mono(formamide)ester: S57 (= S52), T58 (= T53), R59 (= R54), T60 (= T55), R108 (= R103), C270 (= C261), L271 (= L262), R297 (= R289)
- binding norvaline: L130 (= L125), N166 (= N161), D230 (= D221), S234 (= S225), M235 (= M226)
4a8hA Crystal structure of putrescine transcarbamylase from enterococcus faecalis with n-(phosphonoacetyl)-putrescine (see paper)
45% identity, 100% coverage: 1:302/302 of query aligns to 1:310/340 of 4a8hA
- active site: R54 (= R54), T55 (= T55), G82 (≠ R82), R103 (= R103), H130 (= H130), Q133 (= Q133), D227 (= D221), C269 (= C261), R297 (= R289)
- binding n-(phosphonoacetyl)-putrescine: S52 (= S52), T53 (= T53), R54 (= R54), T55 (= T55), R103 (= R103), M125 (≠ L125), H130 (= H130), Q164 (≠ N161), D227 (= D221), C269 (= C261), L270 (= L262), R297 (= R289)
Query Sequence
>WP_011032099.1 NCBI__GCF_000007065.1:WP_011032099.1
MKRDVLSITDLSREEIYELLESAADLKKKRKAGEPTEYLKHKSLGMIFEKSSTRTRVSFE
VAMSDFGGHALYLNSRDIQVGRGETIEDTARTLSGYLHGIMARVMSHDTVEKLARFSTIP
VINALSDREHPCQILGDFMTIMEYKNRFEGLKFAWIGDGNNVCNSALLGSAIMGMEFVIA
CPEGYEPGAEFLEKAKALGGKFSITDDPKTAAKDADIIYTDVWVSMGDEAEQEKRLKDFG
SFQVNTELLGVAKPDVIVMHCLPARRGLEITDEVMDGPNSVIFEEAENRLHAQKALILKL
MR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory