Comparing WP_011033352.1 NCBI__GCF_000007065.1:WP_011033352.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
45% identity, 96% coverage: 15:392/395 of query aligns to 9:390/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
45% identity, 96% coverage: 15:392/395 of query aligns to 1:382/387 of 1wkhA
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
45% identity, 96% coverage: 15:392/395 of query aligns to 1:382/387 of 1wkgA
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
45% identity, 96% coverage: 15:392/395 of query aligns to 1:382/387 of 1vefA
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
45% identity, 94% coverage: 25:394/395 of query aligns to 2:373/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
45% identity, 94% coverage: 25:394/395 of query aligns to 3:374/376 of O66442
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 95% coverage: 18:394/395 of query aligns to 61:451/457 of Q9M8M7
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
46% identity, 93% coverage: 26:392/395 of query aligns to 11:379/390 of A0QYS9
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum (see paper)
45% identity, 96% coverage: 17:394/395 of query aligns to 1:387/390 of 8ht4B
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
44% identity, 93% coverage: 26:392/395 of query aligns to 19:389/400 of P9WPZ7
Sites not aligning to the query:
P73133 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
43% identity, 94% coverage: 25:395/395 of query aligns to 34:424/429 of P73133
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
44% identity, 93% coverage: 26:392/395 of query aligns to 13:383/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
44% identity, 93% coverage: 26:392/395 of query aligns to 13:383/391 of 7nn4A
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
42% identity, 94% coverage: 25:394/395 of query aligns to 2:380/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
42% identity, 94% coverage: 25:394/395 of query aligns to 10:388/393 of 2ordA
8cplC Yzw2 a scaffold for cryo-em of small proteins of interest
44% identity, 88% coverage: 47:395/395 of query aligns to 70:440/499 of 8cplC
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
44% identity, 88% coverage: 47:395/395 of query aligns to 78:448/459 of P42588
4uoyA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate (see paper)
44% identity, 88% coverage: 47:395/395 of query aligns to 72:442/454 of 4uoyA
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
44% identity, 88% coverage: 47:395/395 of query aligns to 72:442/453 of 4uoxA
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
39% identity, 94% coverage: 25:395/395 of query aligns to 3:384/388 of 3nx3A
>WP_011033352.1 NCBI__GCF_000007065.1:WP_011033352.1
MTDKIINSGNLEAGYDSVIDKDSKYVMQTYGRQPLVLSKGKGAVVQDIYGKEYIDCVAGI
AVNNVGHCHPTVVKAIQAQAEKLIHVSNLYYTEIQAEFAETLASITGMECVFFCNSGAEA
VEAAMKLARVATGKSAFVAAEHSFHGRTIGALSVTHKSMYRDPFMPPVSSKTSFVPYSDA
DAIRKAISEDTAAVVLEPIQGEGGVNVPDPGYLKEVREICDETGTLLIFDEVQTGFGRTG
TWFCKEQFGVEPDIMSMAKAIGGGFPMGAIAARSGLSFGRGQHASTFGGGPLACAAALAS
IQAIKEEKLLERSKEMGAYFTKKLSGMARDDIVEVRGKGLMIGVEIKYPCGKFVDFAREH
GVLVNCTSDSVLRLVPPLVITKEQIDSVVDVLEQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory