Comparing WP_011034159.1 NCBI__GCF_000007065.1:WP_011034159.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 90% coverage: 23:407/428 of query aligns to 10:377/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 90% coverage: 22:406/428 of query aligns to 47:423/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 91% coverage: 17:407/428 of query aligns to 10:389/389 of 4ewtA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 90% coverage: 22:406/428 of query aligns to 51:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
32% identity, 76% coverage: 26:352/428 of query aligns to 22:341/398 of 6slfA
Sites not aligning to the query:
>WP_011034159.1 NCBI__GCF_000007065.1:WP_011034159.1
MCRRSEVISLRDDPSGESLESWIIRLRREFHKYPELSFKEYETQKRILKILGELGIEGRK
IADTGVLASIRGTMSGPCIALRTDTDGLQVQEEPAERNREYISRTEGVMHACGHDGHMAM
LFGAARMFMENREFPGEVRLIFQPAEEIPPGGSERVIAEGGLEGVDAIIGMHIFTNHESG
SVGFRPGPFMASTNRFEVILKGKGGHISLPAKCIDPVRMAVDFINSLNSALEERLDKEKY
VLGVGRIQGGAQFNRTPDNVGILGSYRTFDSETTDIIDATIKECLEKIKQEYLKHGEEFS
GLPDYELDILHGYPVLVNDPFFTEAVNLKLHESFPELTVYPEIEKTFAAEDFASYLQVVP
GVFISLGTRNQKKGIVEINHSCAFDIDEEILLKGSEIFHTLSLDFLKHPEKYLSLQKYHG
PQEYIEKT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory