Comparing WP_011189191.1 NCBI__GCF_000025945.1:WP_011189191.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
35% identity, 41% coverage: 7:353/853 of query aligns to 8:360/364 of P97084
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
35% identity, 41% coverage: 7:353/853 of query aligns to 1:353/355 of 1lkcA
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
35% identity, 41% coverage: 7:353/853 of query aligns to 5:357/358 of 1lc7A
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
35% identity, 41% coverage: 7:353/853 of query aligns to 2:354/356 of 1lc8A
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
26% identity, 38% coverage: 21:346/853 of query aligns to 32:356/360 of 8bj3A
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 34% coverage: 50:339/853 of query aligns to 55:370/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 34% coverage: 50:339/853 of query aligns to 55:370/388 of 1gd9A
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
23% identity, 36% coverage: 48:350/853 of query aligns to 74:388/392 of P0DV65
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
27% identity, 38% coverage: 24:347/853 of query aligns to 25:347/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
27% identity, 38% coverage: 24:347/853 of query aligns to 25:347/353 of 4r2nA
Sites not aligning to the query:
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
29% identity, 32% coverage: 71:339/853 of query aligns to 89:370/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
29% identity, 32% coverage: 71:339/853 of query aligns to 89:370/382 of 1gc3A
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
29% identity, 32% coverage: 71:339/853 of query aligns to 89:370/382 of 1b5oA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 26% coverage: 29:248/853 of query aligns to 21:236/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 26% coverage: 29:248/853 of query aligns to 22:237/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
26% identity, 26% coverage: 29:248/853 of query aligns to 22:237/329 of 1h1cA
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
26% identity, 26% coverage: 29:248/853 of query aligns to 28:243/335 of 2f8jA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
29% identity, 32% coverage: 71:339/853 of query aligns to 89:370/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
28% identity, 32% coverage: 71:339/853 of query aligns to 89:370/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
28% identity, 32% coverage: 71:339/853 of query aligns to 89:370/382 of 1bjwA
Sites not aligning to the query:
>WP_011189191.1 NCBI__GCF_000025945.1:WP_011189191.1
MIKRKEHGGNLRKIKAEGAEQKIIDFSANINPLGPPEWLRPVISNELETLIHYPDPDCLE
FCQAIAGHHGISEKRVVAGNGTAELLYALLRIIPSKRIVIPVPSYIDYYHAASQTGQEIV
PVELSPENGFQLSLERLKKILRPGDLALIARPNNPTGLLPDTEQLADIIKSMPEVWFCLD
EAFLDFIADEPSFAGRFENVITLNSMTKFYALPGLRLGYCSCSEELKVALHNALPPWTVN
TLAQAVGKRLFADETYRQQSLAYAEAARRDCFQELSSLDALEVFPSRVNYHLCRLRDGGA
VEPLRKRLLQAGFAIRPCENFSGLDRSYFRVAVRTHEENHLFFQALRTSLATVPSKKKRE
KRPTPALMLQGTCSNAGKSVLTAALCRILVQDGIKVAPFKAQNMSLNSFVTRDGREMGRA
QVVQAQAACIDPHWRMNPILLKPNSDTGSQVIVQGRPVGNMSVGQYHRYKGQAWHKVQES
YDELAAEYDTIILEGAGSPGEVNLKQHDIVNMRMAQHAQSPVLLVGDIDRGGVYASFVGI
MEVLSQWERDLVAGFLVNRFRGDARLLSSAHDYLLQHTGRKVLGVVPYIHQLGIPEEDSV
SFKSGALDSLPPIGDHVVISVLSLPHLSNFTDIEPFLTEPDVHIRIVTRVTELENSDAII
IPGSKNVLGDMRWLQEGGFVEYIKEFATDGGTVVGICGGYQMLGRKISDPHGVESARLSD
EGLGILDIGTEIGEDKKLLRKTGHHISSQTAVHGYEIHHGISVGKSAPLFLFNDGSYCGH
KAENLPVWGAYLHGMFDADDFRRLFIDDLRQKKGLSREGRVLAPYNLDGAFETLAKTVRE
SVDMDAIYHLLGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory