Comparing WP_011317835.1 NCBI__GCF_000204075.1:WP_011317835.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
42% identity, 94% coverage: 7:260/270 of query aligns to 8:269/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
41% identity, 95% coverage: 7:262/270 of query aligns to 4:267/267 of P0ADG4
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
42% identity, 90% coverage: 7:249/270 of query aligns to 4:246/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
41% identity, 90% coverage: 7:249/270 of query aligns to 4:238/255 of 6tqoT
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
43% identity, 84% coverage: 33:260/270 of query aligns to 35:266/271 of Q9M8S8
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
33% identity, 96% coverage: 5:264/270 of query aligns to 4:268/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
33% identity, 96% coverage: 5:264/270 of query aligns to 6:270/277 of P20456
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
35% identity, 94% coverage: 8:262/270 of query aligns to 4:256/258 of 3lv0A
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
33% identity, 96% coverage: 5:264/270 of query aligns to 4:268/274 of 4as5A
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
33% identity, 96% coverage: 5:264/270 of query aligns to 6:270/277 of O55023
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
35% identity, 97% coverage: 5:266/270 of query aligns to 2:267/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
35% identity, 97% coverage: 5:266/270 of query aligns to 2:267/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
35% identity, 97% coverage: 5:266/270 of query aligns to 2:267/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
35% identity, 97% coverage: 5:266/270 of query aligns to 3:268/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
35% identity, 97% coverage: 5:266/270 of query aligns to 4:269/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
35% identity, 97% coverage: 5:266/270 of query aligns to 4:269/275 of 6giuA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
35% identity, 97% coverage: 5:266/270 of query aligns to 6:271/277 of P29218
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
34% identity, 96% coverage: 5:264/270 of query aligns to 2:266/266 of 1imdA
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
35% identity, 94% coverage: 8:262/270 of query aligns to 4:238/238 of 3luzA
Sites not aligning to the query:
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
33% identity, 96% coverage: 5:263/270 of query aligns to 11:279/285 of Q19420
>WP_011317835.1 NCBI__GCF_000204075.1:WP_011317835.1
MTNLQIFLDIATEAALAAGAVLQGYLGKLEDAVTEKGRPGDLVTAADKASEAVVLEIIRR
HFPQHSILAEESGKLGNQDNEYLWAIDPLDGTTNYAHQYPAFCVSIGLLINGVPQVGVIY
DPFHDELFRGAAGLGATRDRRPIKVSDTSELSKSLLVTGFAYDRRETPDNNYAEFCHLTH
LTQGVRRSGSAALDLAHVACGRVDGYWERGISPWDIVAGVILLQEAGGKVTAYDGTPLKI
ATGRILATNGSIHDNLSRALMQVPPLSAWE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory