Comparing WP_011318778.1 NCBI__GCF_000204075.1:WP_011318778.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5djhA Structure of m. Tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound (see paper)
31% identity, 75% coverage: 42:258/290 of query aligns to 35:226/252 of 5djhA
5djgA Structure of m. Tuberculosis cysq, a pap phosphatase with pap, mg, and li bound (see paper)
31% identity, 75% coverage: 42:258/290 of query aligns to 35:228/254 of 5djgA
5djjA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2mg bound (see paper)
32% identity, 75% coverage: 42:258/290 of query aligns to 35:231/257 of 5djjA
5djkA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2ca bound (see paper)
32% identity, 74% coverage: 42:255/290 of query aligns to 29:222/251 of 5djkA
P9WKJ1 3'-phosphoadenosine 5'-phosphate phosphatase; PAP phosphatase; 3'(2'),5'-bisphosphate nucleotidase; 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; D-fructose-1,6-bisphosphate 1-phosphohydrolase; DPNPase; Fructose-1,6-bisphosphatase; FBPase; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.7; EC 3.1.3.11; EC 3.1.3.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 74% coverage: 42:255/290 of query aligns to 40:238/267 of P9WKJ1
4o7iA Structural and functional characterization of 3'(2'),5'-bisphosphate nucleotidase1 from entamoeba histolytica (see paper)
25% identity, 96% coverage: 8:284/290 of query aligns to 7:313/317 of 4o7iA
4hxvA Crystal structure of 3'(2'),5'-bisphosphate nucleotidase1 from entamoeba histolytica in complex with amp and metal ions (see paper)
25% identity, 96% coverage: 8:284/290 of query aligns to 7:313/317 of 4hxvA
C4M4T9 3',5'-bisphosphate nucleotidase; 3'-phosphoadenosine 5'-phosphatase-1; PAP phosphatase-1; Inositol-1,4-bisphosphate 1-phosphatase; EC 3.1.3.7; EC 3.1.3.57 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
25% identity, 96% coverage: 8:284/290 of query aligns to 7:313/317 of C4M4T9
Q9NX62 Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase; Golgi-resident PAP phosphatase; gPAPP; 3'(2'), 5'-bisphosphate nucleotidase 2; Inositol monophosphatase domain-containing protein 1; Myo-inositol monophosphatase A3; Phosphoadenosine phosphate 3'-nucleotidase; EC 3.1.3.7 from Homo sapiens (Human) (see 2 papers)
33% identity, 66% coverage: 92:283/290 of query aligns to 171:353/359 of Q9NX62
Sites not aligning to the query:
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 77% coverage: 30:252/290 of query aligns to 22:239/266 of 1imdA
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
25% identity, 77% coverage: 30:252/290 of query aligns to 34:253/285 of Q19420
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 77% coverage: 30:252/290 of query aligns to 22:239/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
27% identity, 77% coverage: 30:252/290 of query aligns to 22:239/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
27% identity, 77% coverage: 30:252/290 of query aligns to 22:239/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
26% identity, 90% coverage: 30:289/290 of query aligns to 23:272/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
26% identity, 90% coverage: 30:289/290 of query aligns to 24:273/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
26% identity, 90% coverage: 30:289/290 of query aligns to 24:273/275 of 6giuA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
26% identity, 90% coverage: 30:289/290 of query aligns to 26:275/277 of P29218
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
24% identity, 98% coverage: 5:289/290 of query aligns to 4:273/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
24% identity, 98% coverage: 5:289/290 of query aligns to 6:275/277 of P20456
>WP_011318778.1 NCBI__GCF_000204075.1:WP_011318778.1
MKDLQEILAIARAVGWGAAEILQSYYHGTATDSNLNVQYKQNEPVTIADITVSQYILQKL
QAALGQEDFAYVSEETYKSELSEDTKTKTDWVWIIDPLDGTRGFIEKTGDYAVHIALVKE
HRPVLAVVAIPEAEKLYFAIKDSGTFVETRNNSNVLQLSLNNTTKSLEDLKIVVSRSHRN
QKLNYLLEKLPCQQQKSVGSVGCKIATILEQQADLYISLSGTSAPKDWDIAAPELILTEA
GGQFTHFDGSPLQYNTGDINQWGGLLASNGHYHTELCQKIAKILVQFDEM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory