Comparing WP_011320502.1 NCBI__GCF_000204075.1:WP_011320502.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
44% identity, 99% coverage: 2:367/369 of query aligns to 2:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 99% coverage: 2:367/369 of query aligns to 4:365/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 99% coverage: 2:367/369 of query aligns to 2:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 99% coverage: 2:367/369 of query aligns to 2:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 64% coverage: 3:237/369 of query aligns to 1:219/241 of 2akoA
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
32% identity, 69% coverage: 3:256/369 of query aligns to 13:234/236 of 7f5xA
8j0gB Gk monomer complexes with glutamate and atp
37% identity, 69% coverage: 3:257/369 of query aligns to 8:268/274 of 8j0gB
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
33% identity, 69% coverage: 3:256/369 of query aligns to 13:256/258 of 7wx3B
8j0eB Gk monomer complexes with catalytic intermediate
37% identity, 69% coverage: 3:257/369 of query aligns to 11:263/269 of 8j0eB
8j0fA Gk tetramer with adjacent hooks at reaction state
36% identity, 69% coverage: 3:257/369 of query aligns to 12:262/270 of 8j0fA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
28% identity, 30% coverage: 149:258/369 of query aligns to 121:225/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
28% identity, 30% coverage: 149:258/369 of query aligns to 122:226/226 of 2bmuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
27% identity, 30% coverage: 149:258/369 of query aligns to 123:219/219 of 2ji5A
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
26% identity, 36% coverage: 120:252/369 of query aligns to 121:248/253 of 7n9dA
Sites not aligning to the query:
>WP_011320502.1 NCBI__GCF_000204075.1:WP_011320502.1
MTKTIVVKIGTSSLTQPETGQLALSTIATLAETLSYLRQQGNQVILVSSGAVGVGCARLG
LTERPKAIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRSDLVQRSRYLNVYNTF
RELLALGVIPVVNENDTVAVDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
VPDARPISLVTSIKELADLQVQTGSQGSQWGTGGMMTKISAARIAIAAGVRTVITQGRYP
RNIEKIIQGELIGTHFQPQPEPTSARKRWIAYGLVPTGKLYLDSGAIAAIVKAGKSLLPA
GVKTVAGEFEPQDAVQLLDPQGNEIARGLVNYSSKDLQQICGRHSKEISTILGYVGAETV
IHRDNLVLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory