Comparing WP_011365913.1 NCBI__GCF_000012925.1:WP_011365913.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
5odcD Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
48% identity, 50% coverage: 8:135/255 of query aligns to 3:129/138 of 5odcD
7bkbF Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
48% identity, 51% coverage: 6:135/255 of query aligns to 1:129/137 of 7bkbF
>WP_011365913.1 NCBI__GCF_000012925.1:WP_011365913.1
MSTGRDHKPSVVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMCTGRVDLAFVLRAFSK
GADGVFIGGCWPGECHYVTEGNYDVLKNVHIAKKILERIGINPDRLRLEWIAASEGMRYA
EVMNDFGKRLKELGPLGKGEGIEPGALKLRLEAANKLVPYVKLVERERLRQRFKTEQEYT
DFFASDELKKLFDELVANKLAVSQITLLLQDKPLNTGEIVTTLGMNASEVSRHLKSATMH
GLVRFDEELKRYALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory