SitesBLAST
Comparing WP_011372132.1 NCBI__GCF_000012965.1:WP_011372132.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
43% identity, 85% coverage: 2:181/212 of query aligns to 3:180/193 of 2vpyF
- binding pentachlorophenol: I91 (= I90), C93 (= C92)
- binding iron/sulfur cluster: C13 (= C12), G15 (= G14), C16 (= C15), C19 (= C18), C23 (= C22), N27 (= N26), L36 (= L35), I38 (≠ V37), P55 (= P54), Q57 (≠ R56), C58 (= C57), L59 (≠ N58), C61 (= C60), P65 (= P64), C66 (= C65), C70 (= C69), P71 (= P70), V83 (= V82), C90 (= C89), I91 (= I90), A92 (≠ G91), C93 (= C92), G94 (≠ S93), C96 (= C95), C100 (= C99), P101 (= P100), Y102 (= Y101), R105 (≠ I104), V113 (≠ T112), C116 (= C116), F118 (≠ Y118), C119 (= C119), P129 (= P129), A130 (= A130), C131 (= C131), C135 (= C135), C139 (≠ A139), R140 (≠ N140)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
43% identity, 85% coverage: 2:181/212 of query aligns to 3:180/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C12), G15 (= G14), C16 (= C15), C19 (= C18), C23 (= C22), N27 (= N26), L36 (= L35), I38 (≠ V37), P55 (= P54), Q57 (≠ R56), C58 (= C57), L59 (≠ N58), H60 (= H59), C61 (= C60), P65 (= P64), C66 (= C65), C70 (= C69), P71 (= P70), V83 (= V82), C90 (= C89), I91 (= I90), A92 (≠ G91), C93 (= C92), G94 (≠ S93), C96 (= C95), C100 (= C99), P101 (= P100), Y102 (= Y101), R105 (≠ I104), V113 (≠ T112), C116 (= C116), F118 (≠ Y118), C119 (= C119), P129 (= P129), A130 (= A130), C131 (= C131), C135 (= C135), C139 (≠ A139), R140 (≠ N140)
Sites not aligning to the query:
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
35% identity, 87% coverage: 1:185/212 of query aligns to 1:231/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C12), V13 (≠ M13), G14 (= G14), C15 (= C15), G16 (≠ K16), C18 (= C18), C22 (= C22), N26 (= N26), Y52 (≠ F52), P54 (= P54), C57 (= C57), N58 (= N58), H59 (= H59), C60 (= C60), A63 (= A63), P64 (= P64), C65 (= C65), C69 (= C69), P70 (= P70), T82 (≠ V82), C89 (= C89), I90 (= I90), G91 (= G91), C92 (= C92), K93 (≠ S93), C95 (= C95), C99 (= C99), Y101 (= Y101), V103 (≠ A103), I104 (= I104), T161 (≠ A113), K163 (= K115), C164 (= C116), F166 (≠ Y118), C167 (= C119), C179 (= C131), C183 (= C135), P184 (= P136), R188 (≠ N140)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
35% identity, 87% coverage: 1:185/212 of query aligns to 1:231/234 of Q7WTT9
- C12 (= C12) binding [4Fe-4S] cluster
- C15 (= C15) binding [4Fe-4S] cluster
- C18 (= C18) binding [4Fe-4S] cluster
- C22 (= C22) binding [4Fe-4S] cluster
- C57 (= C57) binding [4Fe-4S] cluster
- C60 (= C60) binding [4Fe-4S] cluster
- C65 (= C65) binding [4Fe-4S] cluster
- C69 (= C69) binding [4Fe-4S] cluster
- C89 (= C89) binding [4Fe-4S] cluster
- C92 (= C92) binding [4Fe-4S] cluster
- C95 (= C95) binding [4Fe-4S] cluster
- C99 (= C99) binding [4Fe-4S] cluster
- C164 (= C116) binding [4Fe-4S] cluster
- C167 (= C119) binding [4Fe-4S] cluster
- C179 (= C131) binding [4Fe-4S] cluster
- C183 (= C135) binding [4Fe-4S] cluster
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
38% identity, 69% coverage: 2:147/212 of query aligns to 4:157/205 of P18776
- C102 (= C92) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
40% identity, 65% coverage: 43:179/212 of query aligns to 122:258/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C69), T150 (≠ V71), I153 (≠ L74), C169 (= C89), K170 (≠ I90), G171 (= G91), H172 (≠ C92), R173 (≠ S93), H174 (≠ G94), C175 (= C95), S193 (≠ A113)
- binding protoporphyrin ix containing fe: T150 (≠ V71), K170 (≠ I90), H172 (≠ C92)
- binding iron/sulfur cluster: M135 (≠ R56), C136 (= C57), N137 (= N58), H138 (= H59), C139 (= C60), P142 (≠ A63), C144 (= C65), V162 (= V82), C179 (= C99), A183 (= A103), I184 (= I104), K195 (= K115), C196 (= C116), I197 (≠ T117), L198 (≠ Y118), C199 (= C119), N209 (≠ P129), C211 (= C131), C215 (= C135), V219 (≠ A139), R220 (≠ N140)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41
6f0kB Alternative complex iii (see paper)
30% identity, 74% coverage: 2:157/212 of query aligns to 723:928/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C69), V805 (= V71), M818 (≠ I84), C823 (= C89), I824 (= I90), G825 (= G91), C829 (= C95), M869 (vs. gap)
- binding heme c: N821 (≠ E87), R822 (= R88), R884 (vs. gap), N887 (vs. gap)
- binding iron/sulfur cluster: C733 (= C12), T734 (≠ M13), G735 (= G14), C736 (= C15), N737 (≠ K16), A738 (≠ G17), C739 (= C18), C743 (= C22), W765 (= W33), I768 (≠ L35), C791 (= C57), M792 (≠ N58), H793 (= H59), C794 (= C60), P798 (= P64), C799 (= C65), N816 (≠ V82), C833 (= C99), C872 (= C116), Y874 (= Y118), C875 (= C119), A901 (= A130), C902 (= C131), C906 (= C135)
Sites not aligning to the query:
8k9fB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 2.9 angstrom (see paper)
27% identity, 72% coverage: 4:155/212 of query aligns to 711:917/951 of 8k9fB
- binding fe3-s4 cluster: C787 (= C69), P788 (= P70), M802 (≠ I84), C807 (= C89), G809 (= G91), T810 (≠ C92), K811 (≠ S93), Y812 (≠ G94), C813 (= C95)
- binding heme c: N805 (≠ E87), R806 (= R88), R867 (vs. gap), K871 (vs. gap)
- binding iron/sulfur cluster: C719 (= C12), G721 (= G14), C722 (= C15), N723 (≠ K16), C725 (= C18), C729 (= C22), N733 (= N26), W751 (= W33), I752 (≠ R34), P772 (= P54), C775 (= C57), M776 (≠ N58), Q777 (≠ H59), C778 (= C60), C783 (= C65), N800 (≠ V82), C817 (= C99), Y819 (= Y101), V821 (≠ A103), C856 (= C116), Y858 (= Y118), C859 (= C119), T891 (≠ P129), C893 (= C131), C897 (= C135), P898 (= P136), T899 (≠ V137)
Sites not aligning to the query:
8k9eB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 3.3 angstrom (see paper)
27% identity, 72% coverage: 4:155/212 of query aligns to 711:917/951 of 8k9eB
- binding fe3-s4 cluster: C787 (= C69), M802 (≠ I84), C807 (= C89), V808 (≠ I90), G809 (= G91), T810 (≠ C92), K811 (≠ S93), Y812 (≠ G94), C813 (= C95), M853 (≠ A113)
- binding heme c: N805 (≠ E87), R867 (vs. gap), K871 (vs. gap)
- binding iron/sulfur cluster: C719 (= C12), I720 (≠ M13), G721 (= G14), C722 (= C15), N723 (≠ K16), C725 (= C18), C729 (= C22), N733 (= N26), I754 (≠ R36), C775 (= C57), M776 (≠ N58), C778 (= C60), P782 (= P64), C783 (= C65), N800 (≠ V82), C817 (= C99), Y819 (= Y101), V821 (≠ A103), R822 (vs. gap), C856 (= C116), Y858 (= Y118), C859 (= C119), T891 (≠ P129), C893 (= C131), C897 (= C135), T899 (≠ V137)
Sites not aligning to the query:
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
35% identity, 65% coverage: 42:179/212 of query aligns to 118:255/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C69), I150 (≠ L74), C166 (= C89), K167 (≠ I90), G168 (= G91), A169 (≠ C92), Q170 (≠ S93), A171 (≠ G94), C172 (= C95), A190 (= A113)
- binding iron/sulfur cluster: P130 (= P54), C133 (= C57), N134 (= N58), C136 (= C60), P139 (≠ A63), C141 (= C65), C176 (= C99), C193 (= C116), G195 (≠ Y118), C196 (= C119), C208 (= C131), C212 (= C135), V213 (≠ P136), G214 (≠ V137)
Sites not aligning to the query:
4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
29% identity, 100% coverage: 2:212/212 of query aligns to 3:223/274 of 4v4cB
- binding calcium ion: I61 (≠ R50), N62 (≠ T51)
- binding iron/sulfur cluster: C13 (= C12), Q14 (≠ M13), D15 (≠ G14), C16 (= C15), N17 (≠ K16), N18 (≠ G17), C19 (= C18), C23 (= C22), C68 (= C57), M69 (≠ N58), H70 (= H59), C71 (= C60), C76 (= C65), V92 (= V82), C109 (= C99), V113 (≠ A103), C126 (= C116), M128 (≠ Y118), C129 (= C119), P143 (= P129), C145 (= C131), C149 (= C135), S151 (≠ A139), V153 (≠ I141), Y154 (≠ F142)
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
30% identity, 84% coverage: 2:179/212 of query aligns to 29:227/294 of P0AAJ3
- C39 (= C12) binding [4Fe-4S] cluster
- C42 (= C15) binding [4Fe-4S] cluster
- C45 (= C18) binding [4Fe-4S] cluster
- C49 (= C22) binding [4Fe-4S] cluster
- C100 (= C57) binding [4Fe-4S] cluster
- C103 (= C60) binding [4Fe-4S] cluster
- C108 (= C65) binding [4Fe-4S] cluster
- C112 (= C69) binding [4Fe-4S] cluster
- C133 (= C89) binding [4Fe-4S] cluster
- C136 (= C92) binding [4Fe-4S] cluster
- C139 (= C95) binding [4Fe-4S] cluster
- C143 (= C99) binding [4Fe-4S] cluster
- C160 (= C116) binding [4Fe-4S] cluster
- C163 (= C119) binding [4Fe-4S] cluster
- C175 (= C131) binding [4Fe-4S] cluster
- C179 (= C135) binding [4Fe-4S] cluster
1kqfB Formate dehydrogenase n from e. Coli (see paper)
30% identity, 84% coverage: 2:179/212 of query aligns to 28:226/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (≠ G94)
- binding iron/sulfur cluster: K31 (≠ F5), C38 (= C12), I39 (≠ M13), G40 (= G14), C41 (= C15), K42 (= K16), C44 (= C18), C48 (= C22), N52 (= N26), T77 (≠ D41), M79 (≠ G43), C99 (= C57), M100 (≠ N58), H101 (= H59), C102 (= C60), P105 (≠ A63), C107 (= C65), C111 (= C69), P112 (= P70), I117 (≠ L74), V125 (= V82), C132 (= C89), I133 (= I90), G134 (= G91), C135 (= C92), G136 (≠ S93), Y137 (≠ G94), C138 (= C95), C142 (= C99), I146 (≠ A103), P147 (≠ I104), V156 (≠ A113), K158 (= K115), C159 (= C116), L161 (≠ Y118), C162 (= C119), P172 (= P129), C174 (= C131), C178 (= C135), P179 (= P136), I183 (≠ N140)
Sites not aligning to the query:
6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
27% identity, 71% coverage: 2:152/212 of query aligns to 682:892/929 of 6lodB
- binding fe3-s4 cluster: V758 (≠ I68), C759 (= C69), P760 (= P70), C779 (= C89), V780 (≠ I90), G781 (= G91), T782 (≠ C92), C785 (= C95), M838 (≠ A113)
- binding heme c: N777 (≠ E87), R778 (= R88), R852 (vs. gap), I853 (vs. gap), R856 (vs. gap)
- binding iron/sulfur cluster: C692 (= C12), N693 (≠ M13), S694 (≠ G14), C695 (= C15), N696 (≠ K16), A697 (≠ G17), C698 (= C18), C702 (= C22), N706 (= N26), W724 (≠ R34), I727 (≠ V37), L746 (≠ R56), C747 (= C57), Q748 (≠ N58), Q749 (≠ H59), C750 (= C60), P754 (= P64), C755 (= C65), N772 (≠ V82), C789 (= C99), Y791 (= Y101), V793 (≠ A103), R794 (≠ I104), K840 (= K115), C841 (= C116), F843 (≠ Y118), C844 (= C119), T869 (≠ P129), C871 (= C131), C875 (= C135), I880 (≠ N140)
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
34% identity, 60% coverage: 12:139/212 of query aligns to 14:158/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C12), G16 (= G14), C17 (= C15), K18 (= K16), A19 (≠ G17), C20 (= C18), C24 (= C22), H28 (vs. gap), R48 (≠ V42), C63 (= C57), R64 (≠ N58), H65 (= H59), C66 (= C60), A69 (= A63), C71 (= C65), C75 (= C69), A79 (= A73), I80 (≠ L74), C94 (= C89), I95 (= I90), C97 (= C92), C100 (= C95), C104 (= C99), I109 (= I104), C139 (= C116), L141 (≠ Y118), C142 (= C119), P148 (= P129), C150 (= C131), C154 (= C135), P155 (= P136)
Sites not aligning to the query:
7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
35% identity, 63% coverage: 6:139/212 of query aligns to 6:145/174 of 7qv7A
- binding iron/sulfur cluster: C12 (= C12), L13 (≠ M13), G14 (= G14), C15 (= C15), Y16 (≠ K16), C18 (= C18), C22 (= C22), H26 (≠ E25), L37 (= L35), C51 (= C57), R52 (≠ N58), C54 (= C60), C59 (= C65), C63 (= C69), C82 (= C89), I83 (= I90), G84 (= G91), C85 (= C92), C88 (= C95), C92 (= C99), I97 (= I104), F99 (≠ I106), C125 (= C116), L127 (≠ Y118), C128 (= C119), A136 (= A130), C137 (= C131), C141 (= C135)
8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
31% identity, 67% coverage: 5:147/212 of query aligns to 4:168/214 of 8cm6D
- binding formamide: R59 (= R50), P62 (vs. gap)
- binding iron/sulfur cluster: F4 (= F5), C11 (= C12), T12 (≠ M13), A13 (≠ G14), C14 (= C15), R15 (≠ K16), C17 (= C18), C21 (= C22), K25 (≠ N26), K50 (≠ G43), C73 (= C57), R74 (≠ N58), C76 (= C60), P79 (≠ A63), P80 (= P64), C81 (= C65), V102 (≠ I90), C120 (= C99), I124 (≠ A103), P125 (≠ I104), K136 (= K115), C137 (= C116), D138 (≠ T117), M139 (≠ Y118), C140 (= C119), C152 (= C131), C156 (= C135), P157 (= P136), T158 (≠ V137), T160 (≠ A139), M161 (≠ N140)
8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
31% identity, 67% coverage: 5:147/212 of query aligns to 4:168/214 of 8bqgB
- binding iron/sulfur cluster: F4 (= F5), C11 (= C12), T12 (≠ M13), A13 (≠ G14), C14 (= C15), R15 (≠ K16), C17 (= C18), C21 (= C22), K25 (≠ N26), K50 (≠ G43), C73 (= C57), R74 (≠ N58), C76 (= C60), P80 (= P64), C81 (= C65), V102 (≠ I90), C120 (= C99), I124 (≠ A103), P125 (≠ I104), K136 (= K115), C137 (= C116), M139 (≠ Y118), C140 (= C119), C152 (= C131), C156 (= C135), P157 (= P136), T158 (≠ V137), T160 (≠ A139), M161 (≠ N140)
7b04A of Nitrite oxidoreductase (Nxr) from the anammox bacterium Kuenenia stuttgartiensis.
33% identity, 66% coverage: 41:179/212 of query aligns to 156:305/409 of 7b04A
- binding fe3-s4 cluster: C186 (= C69), I191 (≠ L74), C207 (= C89), R208 (≠ I90), G209 (= G91), Y210 (≠ C92), R211 (≠ S93), K212 (≠ G94), C213 (= C95), S231 (≠ A113)
- binding protoporphyrin ix containing fe: R188 (≠ V71), R208 (≠ I90), Y210 (≠ C92)
- binding iron/sulfur cluster: Q171 (≠ R56), I173 (vs. gap), C174 (= C57), N175 (= N58), H176 (= H59), C177 (= C60), P180 (≠ A63), C182 (= C65), C217 (= C99), P222 (≠ I104), K233 (= K115), C234 (= C116), A236 (≠ Y118), C237 (= C119), T255 (≠ P129), R256 (≠ A130), C257 (= C131), C261 (= C135), V262 (≠ P136), I265 (≠ A139), R266 (≠ N140)
Sites not aligning to the query:
- binding iron/sulfur cluster: 34, 35, 36, 37, 38, 40, 44, 48, 59, 60, 62
8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
32% identity, 69% coverage: 1:146/212 of query aligns to 1:137/158 of 8c0zC
- binding iron/sulfur cluster: C12 (= C12), T13 (≠ M13), C15 (= C15), C18 (= C18), C22 (= C22), C53 (= C57), C56 (= C60), C61 (= C65), C65 (= C69), I70 (≠ L74), C86 (= C89), C89 (= C92), C92 (= C95), C96 (= C99), T100 (≠ A103), K112 (= K115), C113 (= C116), C116 (= C119), C122 (= C131), C126 (= C135), T128 (≠ V137)
Query Sequence
>WP_011372132.1 NCBI__GCF_000012965.1:WP_011372132.1
MQLGFLVDLHLCMGCKGCEIACKVENEVPLSTWRLRVKYVDVGTFPETKRTFTPLRCNHC
ENAPCERICPVSALHYLENGIVNIDKERCIGCSGCVMACPYGAIYIDPQTQTADKCTYCA
HRVASSMMPACVVACPVQANIFGDLEDPTSNISKYIQLHQGGVQVRKPEKGTNPHHYYVN
AGNVSLNPLASHRVDGHSLFNKITTLPVGGHH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory