Comparing WP_011372884.1 NCBI__GCF_000012965.1:WP_011372884.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
42% identity, 97% coverage: 11:391/394 of query aligns to 2:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
42% identity, 97% coverage: 11:391/394 of query aligns to 3:376/376 of O66442
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
38% identity, 95% coverage: 10:384/394 of query aligns to 10:388/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
38% identity, 95% coverage: 10:384/394 of query aligns to 10:388/400 of 4addA
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
37% identity, 97% coverage: 11:394/394 of query aligns to 10:393/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
37% identity, 97% coverage: 11:394/394 of query aligns to 2:385/385 of Q9X2A5
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
37% identity, 98% coverage: 9:394/394 of query aligns to 1:388/388 of 3nx3A
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 97% coverage: 12:394/394 of query aligns to 17:403/405 of P40732
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
36% identity, 97% coverage: 12:394/394 of query aligns to 12:398/402 of 4jevB
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
36% identity, 97% coverage: 12:394/394 of query aligns to 6:387/389 of 2pb0A
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
36% identity, 97% coverage: 12:394/394 of query aligns to 12:393/397 of 4jewA
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
35% identity, 97% coverage: 9:392/394 of query aligns to 7:390/390 of 8ht4B
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 98% coverage: 8:394/394 of query aligns to 65:456/457 of Q9M8M7
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 96% coverage: 16:393/394 of query aligns to 15:385/390 of A0QYS9
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
35% identity, 94% coverage: 16:386/394 of query aligns to 17:381/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
35% identity, 94% coverage: 16:386/394 of query aligns to 17:381/391 of 7nn4A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 94% coverage: 16:386/394 of query aligns to 23:387/400 of P9WPZ7
Sites not aligning to the query:
5e5iA Structure of the ornithine aminotransferase from toxoplasma gondii in complex with inactivator
34% identity, 96% coverage: 8:387/394 of query aligns to 23:410/421 of 5e5iA
5dj9A Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with gabaculine
34% identity, 96% coverage: 8:387/394 of query aligns to 23:410/421 of 5dj9A
5eqcA Structure of the ornithine aminotransferase from toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of plp at the protein active site
34% identity, 96% coverage: 8:387/394 of query aligns to 26:413/426 of 5eqcA
>WP_011372884.1 NCBI__GCF_000012965.1:WP_011372884.1
MNNIKDLDKKYVLPTYARADVEFVSGNNAIVVDANGKKYIDFASGIAVCSVGHANKRVND
AICKQLSNITHTSNLYYIAPQAKAAQKIVEASGYDMKCFFGNSGAEANEGAIKIARKFGE
KDGELKRYKVITLQHSFHGRTITTVKATGQEKMHNYFGPYPDGFVYADNIDHVASLVDDH
TCAVMIELVQGEGGVQPLDRDSVQKLAKFLKEKNVLLIIDEVQTGIYRTGKFLASNYYDI
KPDVVTLAKGLGGGVPIGVVMTTLKDVFGAGDHGSTFGGNFLSTTAACEVVDILNEMNES
GELQKGIDYFDSELEKFYNAHRDIFTSKVGIGMMCGLRVKDGDTLTKIISNAREEGVIVL
KAGRDTLRLLPALTITKEEIDEGFTSLNRTISSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory