SitesBLAST
Comparing WP_011382506.1 NCBI__GCF_000009985.1:WP_011382506.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
63% identity, 95% coverage: 7:286/296 of query aligns to 5:285/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L11), G11 (= G13), G12 (= G14), Q83 (= Q85), P86 (= P88), D87 (≠ A89), G88 (= G90), D111 (= D113), Y115 (= Y117), G116 (= G118), H117 (= H119), D118 (≠ G120), G219 (= G220), R220 (= R221), G221 (= G222), S252 (≠ A253), E256 (= E257), I257 (≠ V258), R260 (= R261)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
63% identity, 95% coverage: 7:286/296 of query aligns to 4:284/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L11), G10 (= G13), Q82 (= Q85), P85 (= P88), G87 (= G90), L108 (= L111), D110 (= D113), Y145 (≠ F147), G146 (= G148), E161 (= E163), K162 (= K164), V172 (= V174), R194 (= R196)
- binding thymidine-5'-diphosphate: Y114 (= Y117), G115 (= G118), H116 (= H119), D117 (≠ G120), R219 (= R221), G220 (= G222), V250 (= V252), S251 (≠ A253)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
63% identity, 95% coverage: 7:286/296 of query aligns to 4:284/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L91), Y145 (≠ F147), G146 (= G148), E161 (= E163), K162 (= K164), V172 (= V174)
- binding thymidine: L8 (= L11), G10 (= G13), G11 (= G14), Q82 (= Q85), P85 (= P88), G87 (= G90), L88 (= L91), D110 (= D113), Y114 (= Y117), G115 (= G118), V250 (= V252), S251 (≠ A253), E255 (= E257), I256 (≠ V258)
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
61% identity, 97% coverage: 7:292/296 of query aligns to 3:289/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L11), G9 (= G13), Q81 (= Q85), P84 (= P88), G86 (= G90), L87 (= L91), D109 (= D113), Y144 (≠ F147), G145 (= G148), E160 (= E163), K161 (= K164), V171 (= V174), Y175 (= Y178), R193 (= R196)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (= Y117), G114 (= G118), H115 (= H119), D116 (≠ G120), G217 (= G220), R218 (= R221), G219 (= G222), E254 (= E257), I255 (≠ V258)
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
62% identity, 96% coverage: 7:289/296 of query aligns to 2:285/294 of 4ho9A
- binding galactose-uridine-5'-diphosphate: L6 (= L11), G8 (= G13), G9 (= G14), Q80 (= Q85), P83 (= P88), G85 (= G90), L86 (= L91), L106 (= L111), D108 (= D113), G144 (= G148), E159 (= E163), K160 (= K164), V170 (= V174), R192 (= R196), W221 (= W225)
- binding uridine 5'-triphosphate: L43 (= L48), G113 (= G118), H114 (= H119), G115 (= G120), T117 (≠ P122), G216 (= G220), R217 (= R221), G218 (= G222), I254 (≠ V258)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
61% identity, 95% coverage: 7:286/296 of query aligns to 5:285/292 of P26393
- T201 (≠ S202) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W225) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
62% identity, 96% coverage: 7:289/296 of query aligns to 2:285/289 of 4ho4A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
62% identity, 96% coverage: 7:289/296 of query aligns to 2:285/288 of 4ho6A
- binding uridine-5'-diphosphate-glucose: L6 (= L11), G8 (= G13), G9 (= G14), Q80 (= Q85), P83 (= P88), G85 (= G90), D108 (= D113), G144 (= G148), E159 (= E163), K160 (= K164), V170 (= V174), R192 (= R196)
- binding uridine 5'-triphosphate: L43 (= L48), Y112 (= Y117), G113 (= G118), H114 (= H119), G115 (= G120), T117 (≠ P122), E253 (= E257), I254 (≠ V258)
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
62% identity, 96% coverage: 7:289/296 of query aligns to 2:285/288 of 4ho5A
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L6 (= L11), G8 (= G13), G9 (= G14), Q24 (≠ H29), Q80 (= Q85), P83 (= P88), G85 (= G90), L86 (= L91), L106 (= L111), D108 (= D113), Y112 (= Y117), G113 (= G118), H114 (= H119), G115 (= G120), F116 (≠ L121), T117 (≠ P122), F143 (= F147), G144 (= G148), E159 (= E163), K160 (= K164), V170 (= V174), G216 (= G220), R217 (= R221), G218 (= G222), W221 (= W225), E253 (= E257), I254 (≠ V258)
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
62% identity, 96% coverage: 7:289/296 of query aligns to 2:285/288 of 4ho3A
- binding thymidine-5'-triphosphate: L6 (= L11), G8 (= G13), G9 (= G14), G11 (= G16), T12 (= T17), R13 (= R18), Q24 (≠ H29), L43 (= L48), Q80 (= Q85), P83 (= P88), G85 (= G90), L86 (= L91), D108 (= D113), Y112 (= Y117), G113 (= G118), H114 (= H119), G115 (= G120), F116 (≠ L121), T117 (≠ P122), E194 (= E198), E253 (= E257), I254 (≠ V258), R257 (= R261)
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
60% identity, 95% coverage: 7:286/296 of query aligns to 5:285/289 of 1iinA
- binding uridine-5'-diphosphate-glucose: L9 (= L11), G11 (= G13), G12 (= G14), R16 (= R18), Q83 (= Q85), P86 (= P88), D87 (≠ A89), G88 (= G90), L89 (= L91), L109 (= L111), D111 (= D113), Y146 (≠ F147), G147 (= G148), E162 (= E163), K163 (= K164), V173 (= V174), R195 (= R196), W224 (= W225)
1iimA Thymidylyltransferase complexed with ttp (see paper)
60% identity, 95% coverage: 7:286/296 of query aligns to 5:285/289 of 1iimA
- binding thymidine-5'-triphosphate: L9 (= L11), G11 (= G13), G12 (= G14), S13 (≠ T15), G14 (= G16), T15 (= T17), R16 (= R18), Q27 (≠ H29), Q83 (= Q85), P86 (= P88), G88 (= G90), L89 (= L91), D111 (= D113), Y115 (= Y117), G116 (= G118), H117 (= H119), P120 (= P122), G219 (= G220), R220 (= R221), G221 (= G222), S252 (≠ A253), E256 (= E257), I257 (≠ V258)
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
60% identity, 95% coverage: 7:286/296 of query aligns to 5:285/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (= G13), G12 (= G14), S13 (≠ T15), G14 (= G16), T15 (= T17), R16 (= R18), K26 (= K28), Q27 (≠ H29), S83 (≠ Q85), P86 (= P88), G110 (= G112), D111 (= D113)
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
60% identity, 95% coverage: 7:286/296 of query aligns to 4:284/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (= G13), G11 (= G14), S12 (≠ T15), G13 (= G16), T14 (= T17), R15 (= R18), K25 (= K28), Q26 (≠ H29), S82 (≠ Q85), P85 (= P88), G109 (= G112), D110 (= D113)
- binding magnesium ion: D110 (= D113), D225 (= D227)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 10:297/302 of 4b2xB
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 1:288/293 of 4b5bA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N,3-dimethylbenzenesulfonamide: S41 (≠ T44), L45 (= L48), Y113 (≠ F116), G115 (= G118), V250 (= V252), A251 (= A253), E255 (= E257), I256 (≠ V258)
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 1:288/293 of 4b4gA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbutane-1-sulfonamide: L45 (= L48), Y113 (≠ F116), G115 (= G118), F118 (≠ L121), V250 (= V252), A251 (= A253), E255 (= E257), I256 (≠ V258), R259 (= R261)
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 1:288/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 7:294/299 of 4b3uA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
62% identity, 97% coverage: 4:290/296 of query aligns to 1:288/293 of 4asyA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzamide: S41 (≠ T44), T42 (= T45), L45 (= L48), Y113 (≠ F116), G115 (= G118), V250 (= V252), E255 (= E257)
Query Sequence
>WP_011382506.1 NCBI__GCF_000009985.1:WP_011382506.1
MTRLPTKGIVLAGGTGTRLHPLTLVTNKHLLPVFDKPMIYYPLTTLMLGGIRDILIISTP
DDLPRFERLLGDGRRWGINLSYAEQPKPAGLPQAFLIGEEFIGGARVGLMLGDNIFYGHG
LPPLVQQAAEGTGATVFAHTVRDPERFGVVTFDASGKAISIEEKPKAPKSNWAVTGLYFY
DADVCQVAATLKPSARGELEISHLNSLYLERGGLSVELLGRGISWLDVGTPEALATAGQF
VHTIQSLQGTGVACPEEVAYRMGFIDRQALADLILPIATSQYGRYLQGLLDHVGAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory