SitesBLAST
Comparing WP_011382508.1 NCBI__GCF_000009985.1:WP_011382508.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
36% identity, 87% coverage: 8:305/341 of query aligns to 1:299/309 of 4zrnA
- active site: T117 (≠ S129), G119 (≠ S130), A120 (≠ S131), Y143 (= Y153), K147 (= K157), Y181 (≠ A191), G185 (= G195)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), N32 (= N39), S34 (≠ A41), S35 (≠ N42), G36 (= G43), S51 (≠ D65), I52 (≠ V66), L73 (= L85), A74 (= A86), A75 (= A87), T92 (≠ A104), S115 (≠ T127), S116 (≠ A128), Y143 (= Y153), K147 (= K157), Y170 (≠ L180), V173 (= V183)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S129), G119 (≠ S130), A120 (≠ S131), Y143 (= Y153), N172 (= N182), G185 (= G195), V186 (≠ A196), H201 (≠ T212), F203 (≠ V214), Y208 (≠ Q219), R210 (= R221), V244 (= V256), R267 (= R273), D270 (≠ E276)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
34% identity, 84% coverage: 9:295/341 of query aligns to 5:290/310 of 6dntA
- active site: S120 (= S129), S121 (= S130), A122 (≠ S131), Y144 (= Y153), K148 (= K157), A187 (= A196)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A89), S120 (= S129), S121 (= S130), Y144 (= Y153), F172 (= F181), N173 (= N182), A187 (= A196), V188 (≠ M197), K191 (≠ V200), V203 (≠ T212), I204 (≠ V213), Y205 (≠ V214), Q210 (= Q219), R212 (= R221), I246 (≠ V256), R269 (= R273), D272 (≠ E276)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), G13 (= G17), F14 (= F18), I15 (= I19), D33 (= D38), N34 (= N39), L35 (≠ F40), S36 (≠ A41), S37 (≠ N42), G38 (= G43), D57 (= D65), L58 (≠ V66), L76 (= L85), A77 (= A86), A78 (= A87), A80 (= A89), S118 (≠ T127), S119 (≠ A128), Y144 (= Y153), K148 (= K157), Y171 (≠ L180), V174 (= V183)
- binding zinc ion: E209 (≠ S218), H275 (≠ C279)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
42% identity, 87% coverage: 8:303/341 of query aligns to 1:301/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A89), R84 (≠ V92), S121 (= S129), G123 (≠ S130), Y146 (= Y153), A174 (≠ F181), N175 (= N182), A187 (≠ Y194), G188 (= G195), V189 (≠ M197), F193 (= F201), R204 (≠ T212), F206 (≠ V214), N211 (≠ Q219), R213 (= R221), D248 (≠ N257), R271 (= R273)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), N32 (= N39), A34 (= A41), T35 (≠ N42), G36 (= G43), D56 (= D65), I57 (≠ V66), L77 (= L85), A78 (= A86), A79 (= A87), I81 (≠ A89), T119 (= T127), Y146 (= Y153), K150 (= K157), P173 (≠ L180), A174 (≠ F181), V176 (= V183)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A89), R84 (≠ V92), S121 (= S129), G123 (≠ S130), Y146 (= Y153), A174 (≠ F181), N175 (= N182), A187 (≠ Y194), G188 (= G195), V189 (≠ M197), F193 (= F201), R204 (≠ T212), F206 (≠ V214), N211 (≠ Q219), R213 (= R221), D248 (≠ N257), R271 (= R273)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
42% identity, 87% coverage: 8:303/341 of query aligns to 1:301/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), N32 (= N39), T35 (≠ N42), G36 (= G43), D56 (= D65), I57 (≠ V66), L77 (= L85), A78 (= A86), A79 (= A87), I81 (≠ A89), T119 (= T127), Y146 (= Y153), K150 (= K157), P173 (≠ L180), N175 (= N182), V176 (= V183)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A89), R84 (≠ V92), S121 (= S129), G123 (≠ S130), S124 (= S131), Y146 (= Y153), A174 (≠ F181), N175 (= N182), G188 (= G195), V189 (≠ M197), F193 (= F201), R204 (≠ T212), V205 (= V213), F206 (≠ V214), N211 (≠ Q219), R213 (= R221), D248 (≠ N257), R271 (= R273)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
42% identity, 87% coverage: 8:303/341 of query aligns to 1:301/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), N32 (= N39), T35 (≠ N42), G36 (= G43), D56 (= D65), I57 (≠ V66), L77 (= L85), A78 (= A86), A79 (= A87), I81 (≠ A89), V96 (≠ A104), T119 (= T127), Y146 (= Y153), K150 (= K157), P173 (≠ L180), A174 (≠ F181), N175 (= N182), V176 (= V183)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A89), R84 (≠ V92), S121 (= S129), G123 (≠ S130), Y146 (= Y153), A174 (≠ F181), N175 (= N182), A187 (≠ Y194), G188 (= G195), V189 (≠ M197), F193 (= F201), R204 (≠ T212), V205 (= V213), F206 (≠ V214), R213 (= R221), D248 (≠ N257), R271 (= R273)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
32% identity, 87% coverage: 11:307/341 of query aligns to 20:333/341 of 1sb8A
- active site: S142 (= S129), S143 (= S130), S144 (= S131), Y166 (= Y153), K170 (= K157), N204 (≠ A191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G14), G26 (= G17), F27 (= F18), I28 (= I19), D47 (= D38), N48 (= N39), F49 (= F40), T51 (≠ N42), G52 (= G43), D78 (= D65), I79 (≠ V66), Q98 (≠ L85), A100 (= A87), T117 (≠ A104), A140 (≠ T127), A141 (= A128), Y166 (= Y153), K170 (= K157), Y193 (≠ L180), N195 (= N182), V196 (= V183)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ D90), S142 (= S129), S143 (= S130), S144 (= S131), Y166 (= Y153), N195 (= N182), A209 (= A196), V210 (≠ M197), W214 (≠ F201), Y225 (≠ T212), I226 (≠ V213), N227 (≠ V214), R234 (= R221), L271 (≠ V256), R299 (= R273), D302 (≠ E276), S306 (≠ T280)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
32% identity, 87% coverage: 11:307/341 of query aligns to 19:332/340 of 1sb9A
- active site: S141 (= S129), S142 (= S130), S143 (= S131), Y165 (= Y153), K169 (= K157), N203 (≠ A191)
- binding nicotinamide-adenine-dinucleotide: G22 (= G14), G25 (= G17), F26 (= F18), I27 (= I19), D46 (= D38), N47 (= N39), F48 (= F40), T50 (≠ N42), G51 (= G43), D77 (= D65), I78 (≠ V66), Q97 (≠ L85), A99 (= A87), T116 (≠ A104), A139 (≠ T127), A140 (= A128), Y165 (= Y153), K169 (= K157), Y192 (≠ L180), N194 (= N182), V195 (= V183)
- binding uridine-5'-diphosphate-glucose: S141 (= S129), Y165 (= Y153), N194 (= N182), A208 (= A196), V209 (≠ M197), W213 (≠ F201), Y224 (≠ T212), I225 (≠ V213), N226 (≠ V214), L270 (≠ V256), R298 (= R273), D301 (≠ E276)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
36% identity, 87% coverage: 9:303/341 of query aligns to 3:301/308 of 6wj9B
- active site: A119 (≠ S129), A120 (≠ S130), A121 (≠ S131), F144 (≠ Y153), K148 (= K157)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (= F18), I13 (= I19), D32 (= D38), D33 (≠ N39), S35 (≠ A41), T36 (≠ N42), G37 (= G43), D55 (= D65), A56 (≠ V66), L75 (= L85), A76 (= A86), A77 (= A87), S94 (≠ A104), A117 (≠ T127), A119 (≠ S129), F144 (≠ Y153), K148 (= K157), F171 (≠ L180), F172 (= F181), I174 (≠ V183)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ I91), N173 (= N182), G187 (≠ A196), V188 (≠ M197), F192 (= F201), T203 (= T212), L204 (≠ V213), F205 (≠ V214), R212 (= R221), L248 (≠ V256), R271 (= R273), D274 (≠ E276)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
36% identity, 87% coverage: 9:303/341 of query aligns to 2:300/307 of 6wjaA
- active site: A118 (≠ S129), A119 (≠ S130), A120 (≠ S131), F143 (≠ Y153), K147 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), D32 (≠ N39), S34 (≠ A41), T35 (≠ N42), G36 (= G43), A55 (≠ V66), L74 (= L85), A75 (= A86), A76 (= A87), S93 (≠ A104), F143 (≠ Y153), K147 (= K157), F170 (≠ L180), F171 (= F181), I173 (≠ V183)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ I91), A120 (≠ S131), N172 (= N182), G186 (≠ A196), V187 (≠ M197), F191 (= F201), T202 (= T212), F204 (≠ V214), R211 (= R221), L247 (≠ V256), R270 (= R273), D273 (≠ E276)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
34% identity, 87% coverage: 8:303/341 of query aligns to 1:302/313 of 6bwlA
- active site: T122 (vs. gap), C123 (vs. gap), M124 (≠ F124), Y147 (= Y153), K151 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D31 (= D38), N32 (= N39), L33 (≠ F40), N35 (= N42), S36 (≠ G43), D57 (= D65), I58 (≠ V66), L79 (= L85), A80 (= A86), A81 (= A87), I83 (≠ A89), M120 (vs. gap), K151 (= K157), N176 (= N182), T177 (≠ V183)
- binding uridine-5'-diphosphate: N176 (= N182), G189 (≠ A196), V190 (≠ M197), N205 (≠ T212), I206 (≠ V213), Y207 (≠ V214), Q212 (= Q219), R214 (= R221), I250 (≠ V256), E275 (= E276)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
34% identity, 87% coverage: 8:303/341 of query aligns to 1:303/314 of 6zldA
- active site: T126 (≠ S129), S127 (= S130), S128 (= S131), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D32 (= D38), H33 (≠ N39), F34 (= F40), I35 (≠ A41), K43 (≠ A49), D62 (= D65), I63 (≠ V66), L81 (= L85), A82 (= A86), A83 (= A87), I124 (≠ T127), T126 (≠ S129), K153 (= K157), Y176 (≠ L180), T178 (≠ N182), R185 (= R189), M188 (≠ A196)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A89), R88 (≠ V92), T126 (≠ S129), S127 (= S130), S128 (= S131), Y149 (= Y153), F177 (= F181), T178 (≠ N182), R185 (= R189), M188 (≠ A196), A189 (≠ M197), R192 (≠ V200), T204 (= T212), F206 (≠ V214), Q211 (= Q219), R213 (= R221), I250 (≠ V256), E276 (= E276)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
34% identity, 87% coverage: 8:303/341 of query aligns to 1:303/314 of 6zl6A
- active site: T126 (≠ S129), S127 (= S130), S128 (= S131), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D32 (= D38), H33 (≠ N39), F34 (= F40), I35 (≠ A41), K43 (≠ A49), D62 (= D65), I63 (≠ V66), L81 (= L85), A82 (= A86), A83 (= A87), I124 (≠ T127), T126 (≠ S129), K153 (= K157), Y176 (≠ L180), T178 (≠ N182), V179 (= V183), R185 (= R189), M188 (≠ A196)
- binding uridine-5'-diphosphate: T178 (≠ N182), A189 (≠ M197), R192 (≠ V200), T204 (= T212), F206 (≠ V214), Q211 (= Q219), R213 (= R221), I250 (≠ V256), E276 (= E276)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
34% identity, 87% coverage: 8:303/341 of query aligns to 1:303/321 of 6zllA
- active site: T126 (≠ S129), S127 (= S130), S128 (= S131), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D32 (= D38), H33 (≠ N39), F34 (= F40), I35 (≠ A41), K43 (≠ A49), D62 (= D65), I63 (≠ V66), L81 (= L85), A82 (= A86), A83 (= A87), I124 (≠ T127), T126 (≠ S129), Y149 (= Y153), K153 (= K157), Y176 (≠ L180), V179 (= V183), R185 (= R189), M188 (≠ A196)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A89), V87 (≠ I91), R88 (≠ V92), T126 (≠ S129), S127 (= S130), Y149 (= Y153), T178 (≠ N182), R185 (= R189), A189 (≠ M197), R192 (≠ V200), T204 (= T212), F206 (≠ V214), Q211 (= Q219), R213 (= R221), I250 (≠ V256), E276 (= E276)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
32% identity, 87% coverage: 10:304/341 of query aligns to 91:385/420 of Q8NBZ7
- G98 (= G17) binding
- F99 (= F18) binding
- V100 (≠ I19) binding
- D119 (= D38) binding
- N120 (= N39) binding
- F122 (≠ A41) binding
- T123 (≠ N42) binding
- G124 (= G43) binding
- D144 (= D70) binding
- V145 (≠ I71) binding
- L149 (≠ M75) binding
- Y150 (≠ F76) binding
- L159 (= L85) binding
- S161 (≠ A87) binding
- K177 (≠ R103) binding
- T178 (≠ A104) binding
- N185 (≠ A111) binding
- G188 (≠ E114) binding
- K191 (≠ R117) binding
- R192 (≠ A118) binding
- A200 (≠ T127) binding
- E204 (≠ S131) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y153) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K157) binding
- R236 (≠ W158) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (≠ W167) binding
- Q248 (≠ T170) binding
- E249 (≠ Y171) binding
- T261 (≠ V183) binding
- H267 (≠ R189) binding
- R272 (≠ A196) binding
- R361 (≠ T280) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
32% identity, 87% coverage: 10:304/341 of query aligns to 4:298/312 of 2b69A
- active site: T115 (≠ S129), S116 (= S130), E117 (≠ S131), Y144 (= Y153), K148 (= K157), R185 (≠ A196)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (= F18), V13 (≠ I19), D32 (= D38), N33 (= N39), T36 (≠ N42), G37 (= G43), D57 (= D70), V58 (≠ I71), L72 (= L85), A73 (= A86), S74 (≠ A87), A76 (= A89), T91 (≠ A104), T115 (≠ S129), Y144 (= Y153), K148 (= K157), I171 (≠ L180), N173 (= N182), R185 (≠ A196)
- binding uridine-5'-diphosphate: P61 (= P74), L62 (≠ M75), Y63 (≠ F76), P78 (≠ I91), N98 (≠ A111), G101 (≠ E114), L102 (≠ A115), K104 (≠ R117), R105 (≠ A118), Y158 (≠ W167), N173 (= N182), R185 (≠ A196), V186 (≠ M197), N189 (≠ V200), T201 (= T212), Y203 (≠ V214), Q208 (= Q219), R210 (= R221), I244 (≠ V256), D270 (≠ E276)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
34% identity, 87% coverage: 8:303/341 of query aligns to 1:303/314 of 6zljA
- active site: T126 (≠ S129), S127 (= S130), S128 (= S131), F149 (≠ Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), F11 (= F18), I12 (= I19), D32 (= D38), H33 (≠ N39), F34 (= F40), I35 (≠ A41), K43 (≠ A49), D62 (= D65), I63 (≠ V66), L81 (= L85), A82 (= A86), A83 (= A87), I124 (≠ T127), T126 (≠ S129), K153 (= K157), Y176 (≠ L180), T178 (≠ N182), V179 (= V183), R185 (= R189), M188 (≠ A196)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A89), R88 (≠ V92), T126 (≠ S129), S127 (= S130), S128 (= S131), F149 (≠ Y153), F177 (= F181), T178 (≠ N182), R185 (= R189), M188 (≠ A196), A189 (≠ M197), R192 (≠ V200), T204 (= T212), F206 (≠ V214), Q211 (= Q219), R213 (= R221), I250 (≠ V256), E276 (= E276)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
33% identity, 87% coverage: 10:304/341 of query aligns to 89:383/418 of Q6GMI9
- R234 (≠ W158) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
35% identity, 86% coverage: 11:303/341 of query aligns to 3:277/290 of 3eheA
- active site: T111 (≠ S129), S112 (= S130), T113 (≠ S131), Y135 (= Y153), K139 (= K157)
- binding nicotinamide-adenine-dinucleotide: G6 (= G14), G9 (= G17), F10 (= F18), I11 (= I19), D29 (= D38), N30 (= N39), L31 (≠ F40), S32 (≠ A41), S33 (≠ N42), G34 (= G43), D49 (= D65), L50 (≠ V66), I68 (≠ L85), A69 (= A86), A70 (= A87), T109 (= T127), Y135 (= Y153), K139 (= K157), F162 (≠ L180), A163 (≠ F181), N164 (= N182), V165 (= V183)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
33% identity, 87% coverage: 7:303/341 of query aligns to 19:332/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 14:19) binding
- DNFSTG 50:55 (≠ DNFANG 38:43) binding
- DI 81:82 (≠ DV 65:66) binding
- QAA 101:103 (≠ LAA 85:87) binding
- T120 (≠ A104) binding
- SS 145:146 (= SS 129:130) binding
- S147 (= S131) mutation to T: No effect on epimerase activity.
- Y169 (= Y153) binding
- K173 (= K157) binding
- YFN 196:198 (≠ LFN 180:182) binding
- V199 (= V183) binding
- VIPK 213:216 (≠ MFGV 197:200) binding
- YIN 228:230 (≠ TVV 212:214) binding
- S236 (≠ T220) mutation to G: No effect on epimerase activity.
- R237 (= R221) binding
- R271 (≠ T253) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RPGE 273:276) binding
- R307 (≠ D278) mutation to A: No effect on epimerase activity.
- H308 (≠ C279) mutation to A: No effect on epimerase activity.
- S309 (≠ T280) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
33% identity, 87% coverage: 7:303/341 of query aligns to 16:324/336 of 3ruhA
- active site: S142 (= S129), S143 (= S130), S144 (= S131), Y166 (= Y153), K170 (= K157), N204 (≠ A191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G14), G26 (= G17), F27 (= F18), I28 (= I19), D47 (= D38), N48 (= N39), S50 (≠ A41), T51 (≠ N42), G52 (= G43), D78 (= D65), I79 (≠ V66), Q98 (≠ L85), A99 (= A86), A100 (= A87), T117 (≠ A104), A140 (≠ T127), A141 (= A128), S142 (= S129), Y166 (= Y153), K170 (= K157), Y193 (≠ L180), V196 (= V183)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A89), S103 (≠ D90), S142 (= S129), S143 (= S130), S144 (= S131), Y166 (= Y153), Y193 (≠ L180), N195 (= N182), A209 (= A196), V210 (≠ M197), K213 (≠ V200), W214 (≠ F201), Y225 (≠ T212), I226 (≠ V213), N227 (≠ V214), R234 (= R221), L271 (≠ V256), R294 (= R273), D297 (≠ E276), V298 (≠ P277), S301 (≠ T280)
Query Sequence
>WP_011382508.1 NCBI__GCF_000009985.1:WP_011382508.1
MTNASPPLHCLVTGGAGFIGSHLVDRLLADGHRVSVIDNFANGREENLADAKASAPDRLT
VHRADVADADIIRPMFAGVDWVFHLAAMADIVPSIQDPMLYHRANVDGTIAVLEAARAAG
VKRFVYTASSSCYGIPETYPTPETAAPSPMYPYALTKWVGEQYVMHWAQTYDLAAVSLRL
FNVYGPRHRTAGTYGAMFGVFLAQRLAGKPYTVVGDGSQTRDFTFVADVADAFVTAANSK
ISGEIFNVGSDGTYSVNRIIEILGGDKLHIPKRPGEPDCTWADIAKIKRVLGWKPKVSLE
EGVGILLGHIDGWRDAPVWTPETIGEATRDWFKYLGKDANG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory