SitesBLAST
Comparing WP_011382553.1 NCBI__GCF_000009985.1:WP_011382553.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
40% identity, 86% coverage: 20:155/159 of query aligns to 5:144/294 of 4mzuF
- binding coenzyme a: N81 (= N78), D82 (= D79), K83 (≠ V80), G100 (= G111), A101 (≠ S112), L106 (= L117), G118 (≠ A129), A119 (= A130), T124 (= T135), K125 (= K136), I134 (≠ A145), N136 (≠ V147), R139 (≠ V150)
- binding thymine: W20 (≠ G35), Q21 (≠ A36), C38 (≠ S53)
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
40% identity, 86% coverage: 20:155/159 of query aligns to 5:143/290 of 4mzuB
- binding coenzyme a: F72 (= F69), T80 (= T77), N81 (= N78), D82 (= D79), K83 (≠ V80), P85 (= P82), G99 (= G111), A100 (≠ S112), G117 (≠ A129), A118 (= A130), T123 (= T135), K124 (= K136), I133 (≠ A145), R138 (≠ V150)
- binding magnesium ion: G58 (vs. gap), N76 (≠ G73)
- binding thymine: W20 (≠ G35), Q21 (≠ A36), C38 (≠ S53), A39 (≠ S54)
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
40% identity, 75% coverage: 20:138/159 of query aligns to 7:131/141 of 7s45A
- binding acetyl coenzyme *a: W64 (≠ C59), T82 (= T77), N83 (= N78), D84 (= D79), K85 (≠ V80), Y86 (= Y81), P87 (= P82), L110 (= L117), T128 (= T135), K129 (= K136)
- binding thymidine-5'-diphosphate: F44 (= F57), E46 (vs. gap)
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
39% identity, 75% coverage: 20:138/159 of query aligns to 7:135/145 of 7s42A
- binding [(2~{R},3~{R},4~{S},5~{R},6~{R})-4-acetamido-6-methyl-3,5-bis(oxidanyl)oxan-2-yl] [[(2~{R},3~{S},5~{R})-5-[5-methyl-2,4-bis(oxidanylidene)pyrimidin-1-yl]-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: F44 (= F57), E46 (vs. gap), W64 (≠ C59), N83 (= N78), D84 (= D79), Y92 (≠ P87)
- binding coenzyme a: C82 (≠ T77), D84 (= D79), K85 (≠ V80), Y86 (= Y81), P87 (= P82), L114 (= L117), T132 (= T135), K133 (= K136)
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
39% identity, 75% coverage: 20:138/159 of query aligns to 7:135/145 of 7s41A
- binding [(2~{R},3~{R},4~{S},5~{S},6~{R})-4-acetamido-6-methyl-3,5-bis(oxidanyl)oxan-2-yl] [[(2~{R},3~{S},5~{R})-5-[5-methyl-2,4-bis(oxidanylidene)pyrimidin-1-yl]-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate : F44 (= F57), E46 (vs. gap), W64 (≠ C59), N83 (= N78), D84 (= D79), Y92 (≠ P87)
- binding coenzyme a: C82 (≠ T77), D84 (= D79), K85 (≠ V80), Y86 (= Y81), P87 (= P82), L114 (= L117), T132 (= T135), K133 (= K136)
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
39% identity, 75% coverage: 20:138/159 of query aligns to 7:135/145 of 7s3wA
- binding oxidized coenzyme a: C82 (≠ T77), D84 (= D79), K85 (≠ V80), Y86 (= Y81), P87 (= P82), L114 (= L117), T132 (= T135), K133 (= K136)
- binding (3R,4S,5R,6R)-4-amino-3,5-dihydroxy-6-methyloxan-2-yl][hydroxy-[[(2R,3S,5R)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphoryl] hydrogen phosphate: F44 (= F57), E46 (vs. gap), D84 (= D79), Y92 (≠ P87)
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
39% identity, 75% coverage: 20:138/159 of query aligns to 7:135/145 of 7s3uA
- binding coenzyme a: C82 (≠ T77), N83 (= N78), D84 (= D79), K85 (≠ V80), Y86 (= Y81), P87 (= P82), L114 (= L117), T132 (= T135), K133 (= K136)
- binding [(3R,4S,5S,6R)-4-amino-3,5-dihydroxy-6-methyloxan-2-yl][hydroxy-[[(2R,3S,5R)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphoryl] hydrogen phosphate: F44 (= F57), E46 (vs. gap), D84 (= D79), Y92 (≠ P87)
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 84% coverage: 25:157/159 of query aligns to 14:157/191 of G3XD01
- K136 (= K136) mutation to A: Reduction in catalytic activity.; mutation to R: No effect on catalytic activity.
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
36% identity, 97% coverage: 3:156/159 of query aligns to 12:157/192 of 3mqgC
- binding acetyl coenzyme *a: Y67 (≠ C59), F77 (= F69), P80 (≠ H72), T85 (= T77), N86 (= N78), V87 (≠ D79), Y88 (≠ V80), P90 (= P82), G112 (= G111), A113 (≠ S112), F128 (≠ L127), G130 (≠ A129), A131 (= A130), N136 (≠ T135), V146 (≠ A145), P149 (= P148), R151 (≠ V150)
- binding uridine-5'-monophosphate: H29 (≠ N22), F47 (≠ E39)
- binding uridine-5'-diphosphate: W25 (≠ F16), S41 (≠ K33), N62 (≠ S54)
Sites not aligning to the query:
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
36% identity, 97% coverage: 3:156/159 of query aligns to 11:156/191 of 3mqhA
- binding coenzyme a: F76 (= F69), T84 (= T77), N85 (= N78), V86 (≠ D79), Y87 (≠ V80), P89 (= P82), G111 (= G111), A112 (≠ S112), A130 (= A130), N135 (≠ T135), V145 (≠ A145), P148 (= P148), R150 (≠ V150)
- binding (2S,3S,4R,5R,6R)-5-(acetylamino)-4-amino-6-{[(R)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-3-hydroxytetrahydro-2H-pyran-2-carboxylic acid: W24 (≠ F16), H28 (≠ N22), F46 (≠ E39), Q60 (≠ S53), N61 (≠ S54), Y66 (≠ C59), F76 (= F69), N85 (= N78), V86 (≠ D79), R95 (≠ T93), Y99 (≠ W97)
Sites not aligning to the query:
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
38% identity, 79% coverage: 25:149/159 of query aligns to 104:216/260 of 3fsbA
- binding coenzyme a: F150 (≠ G71), A178 (≠ G111), A179 (≠ S112), G196 (≠ A129), A197 (= A130), V212 (≠ A145)
- binding [(3R,4S,5S,6R)-4-amino-3,5-dihydroxy-6-methyloxan-2-yl][hydroxy-[[(2R,3S,5R)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphoryl] hydrogen phosphate: G114 (= G35), H132 (≠ S53), F150 (≠ G71)
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
38% identity, 79% coverage: 25:149/159 of query aligns to 104:216/259 of 3fscA
- binding coenzyme a: F150 (≠ G71), A178 (≠ G111), A179 (≠ S112), G196 (≠ A129), A197 (= A130), V212 (≠ A145)
- binding (3R,4S,5R,6R)-4-amino-3,5-dihydroxy-6-methyloxan-2-yl][hydroxy-[[(2R,3S,5R)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphoryl] hydrogen phosphate: K112 (= K33), G114 (= G35), T115 (≠ A36), H132 (≠ S53), S133 (= S54)
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
38% identity, 79% coverage: 25:149/159 of query aligns to 104:216/259 of 3fs8A
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 78% coverage: 35:158/159 of query aligns to 60:187/200 of 1krrA
- binding acetyl coenzyme *a: N84 (≠ C59), I103 (≠ F76), A104 (≠ T77), P105 (≠ N78), T112 (= T85), H114 (≠ P87), G140 (= G111), S141 (= S112), N146 (≠ L117), G158 (≠ A129), A159 (= A130), A174 (= A145), P177 (= P148), R182 (≠ G153)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 78% coverage: 35:158/159 of query aligns to 61:188/203 of P07464
- S71 (≠ T45) binding
- N85 (≠ C59) binding in other chain; binding in other chain
- D93 (≠ E67) binding
- H115 (≠ P87) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (= S112) binding in other chain
- A160 (= A130) binding in other chain
- TK 165:166 (= TK 135:136) binding
- R180 (≠ V150) binding
- R183 (≠ G153) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 78% coverage: 35:158/159 of query aligns to 60:187/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: S70 (≠ T45), Y82 (≠ F57), N84 (≠ C59), V90 (≠ E65), D92 (≠ E67), M126 (≠ W97)
- binding coenzyme a: A104 (≠ T77), S110 (≠ R83), T112 (= T85), W138 (≠ S109), G140 (= G111), S141 (= S112), N146 (≠ L117), A159 (= A130), P177 (= P148), R179 (≠ V150), R182 (≠ G153)
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 78% coverage: 35:158/159 of query aligns to 60:187/201 of 1kruA
- binding coenzyme a: H114 (≠ P87), W138 (≠ S109), G140 (= G111), S141 (= S112), G158 (≠ A129), A159 (= A130), P177 (= P148), R182 (≠ G153)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: W62 (≠ F37), S70 (≠ T45), Y82 (≠ F57), Y82 (≠ F57), N84 (≠ C59), V90 (≠ E65), D92 (≠ E67), L102 (≠ M75), H114 (≠ P87), M126 (≠ W97)
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
30% identity, 91% coverage: 14:157/159 of query aligns to 26:188/188 of 3igjC
- binding acetyl coenzyme *a: F84 (= F57), A106 (≠ T77), Y112 (≠ P82), A114 (= A84), H116 (≠ T86), G142 (= G111), N148 (≠ L117), A160 (= A129), S161 (≠ A130), T166 (= T135), N178 (≠ V147)
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
29% identity, 96% coverage: 3:155/159 of query aligns to 78:210/216 of P71063
- H146 (≠ F69) mutation to L: Loss of activity. Affects the oligomeric state.
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
30% identity, 70% coverage: 46:157/159 of query aligns to 68:183/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (= Y81), H111 (≠ T85), G137 (= G111), A155 (= A129), A156 (= A130), N161 (≠ T135), G171 (≠ A145), T173 (≠ V147), P174 (= P148), L178 (≠ V152), R179 (≠ G153)
- binding magnesium ion: N157 (≠ G131), T173 (≠ V147)
Query Sequence
>WP_011382553.1 NCBI__GCF_000009985.1:WP_011382553.1
MPVTETVTLGKDVRIFQPDLVNLYGCSIGDETKIGAFVEIQGGATIGARCKISSHSFVCE
GVTIEDEVFVGHGVMFTNDVYPRATTPDGALATAADWTCSPTVVKRRASIGSGATILPNL
TIGENALVAAGAVVTKDVPANAIVAGVPAVVVGEVADKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory