Comparing WP_011382577.1 NCBI__GCF_000009985.1:WP_011382577.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
29% identity, 92% coverage: 21:361/371 of query aligns to 1:335/335 of 1geyA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 89% coverage: 34:362/371 of query aligns to 28:350/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 89% coverage: 34:362/371 of query aligns to 28:350/354 of 1fg3A
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
27% identity, 88% coverage: 34:361/371 of query aligns to 28:349/353 of 7szpA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
27% identity, 75% coverage: 35:312/371 of query aligns to 15:280/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
27% identity, 75% coverage: 35:312/371 of query aligns to 16:281/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
27% identity, 75% coverage: 35:312/371 of query aligns to 16:281/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
27% identity, 75% coverage: 35:312/371 of query aligns to 21:286/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
27% identity, 75% coverage: 35:312/371 of query aligns to 22:287/335 of 2f8jA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
27% identity, 91% coverage: 26:361/371 of query aligns to 27:356/360 of 8bj3A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
29% identity, 76% coverage: 38:320/371 of query aligns to 32:318/369 of 4r8dA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
30% identity, 77% coverage: 33:319/371 of query aligns to 22:308/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
30% identity, 77% coverage: 33:319/371 of query aligns to 22:308/353 of 4r2nA
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
30% identity, 78% coverage: 36:324/371 of query aligns to 30:321/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
30% identity, 78% coverage: 36:324/371 of query aligns to 28:319/364 of 3cq6A
Sites not aligning to the query:
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
26% identity, 56% coverage: 62:267/371 of query aligns to 62:272/402 of P14909
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
27% identity, 64% coverage: 75:310/371 of query aligns to 58:295/354 of 3ly1D
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
23% identity, 71% coverage: 54:318/371 of query aligns to 48:314/369 of 4wbtA
8ffuA Structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine, with the substrate bound (see paper)
29% identity, 46% coverage: 82:251/371 of query aligns to 65:233/360 of 8ffuA
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
25% identity, 74% coverage: 37:310/371 of query aligns to 62:305/384 of 1o4sB
>WP_011382577.1 NCBI__GCF_000009985.1:WP_011382577.1
MSASRFAPPSPRPEIADSGLTRPDWVGNNPRDPGKLWLDKNENTDPAMIELVRSVIASVP
ADAGFTYPDLGPVYRKLAPMVGVPPQCLLLTPGSDGAIRAVFEAYIAPGDKVLHTVPTFA
MYGVYARMYGAQVTGLEYRPSNAGPVLHADDVVAAIATSKPKLVGLPNPDSPTGTVFSQA
DLRRIIEAAGEGGALILIDEAYYPFHAETVLPWVMEYPHLVVCRSTGKAWGMAGVRVGYA
AAHPDVAVMLHKVRAMYEVGALSAAVFERMLDHEDAMRESVARISAGKAHFLAAMDELGF
QTLKGQGNFLHVAFGARAEAIHAALAPQVYYRKDFAEPCLKGFSRFSATTAELFNPVIEA
IRDVVKGEGQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory