SitesBLAST
Comparing WP_011382585.1 NCBI__GCF_000009985.1:WP_011382585.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e18A Crystal structure of NAD-binding protein from listeria innocua
28% identity, 63% coverage: 50:246/314 of query aligns to 45:250/348 of 3e18A
- active site: K94 (= K99), H178 (= H174)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ S75), T71 (= T76), P72 (= P77), N73 (≠ P78), H76 (= H81), E93 (= E98), K94 (= K99), N122 (≠ T127), W161 (vs. gap), R162 (vs. gap), H178 (= H174)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
32% identity, 50% coverage: 53:208/314 of query aligns to 45:213/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K99), R150 (= R151), W157 (≠ H157), F160 (≠ Y160), D173 (= D170), H177 (= H174)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ H59), Y52 (≠ W60), C67 (≠ S75), T68 (= T76), P69 (= P77), H73 (= H81), E90 (= E98), K91 (= K99), P92 (= P100), Q119 (≠ T127), V159 (≠ P159), F160 (≠ Y160), Q166 (≠ K162)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
32% identity, 49% coverage: 56:208/314 of query aligns to 58:223/363 of 7xreC
Sites not aligning to the query:
5b3vA Crystal structure of biliverdin reductase in complex with biliverdin and NADP+ from synechocystis sp. Pcc 6803 (see paper)
26% identity, 75% coverage: 9:244/314 of query aligns to 2:251/317 of 5b3vA
- active site: E93 (= E98), Y94 (≠ K99), E120 (= E125), E123 (≠ Q128), S176 (≠ H174), R177 (≠ D175)
- binding biliverdine ix alpha: Y12 (≠ R19), Y94 (≠ K99), I122 (≠ T127), M151 (vs. gap), Q153 (≠ G155), T161 (vs. gap), R177 (≠ D175), R177 (≠ D175), R180 (≠ Q178), K229 (≠ N225), R238 (= R231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ A17), G11 (= G18), Y12 (≠ R19), A13 (≠ W20), N35 (≠ S41), N39 (≠ E45), A70 (≠ S75), T71 (= T76), I72 (≠ P77), N73 (≠ P78), H76 (= H81), E93 (= E98), Y94 (≠ K99), E120 (= E125), W160 (vs. gap)
Sites not aligning to the query:
5b3uB Crystal structure of biliverdin reductase in complex with NADP+ from synechocystis sp. Pcc 6803 (see paper)
26% identity, 75% coverage: 9:244/314 of query aligns to 3:252/317 of 5b3uB
- active site: E94 (= E98), Y95 (≠ K99), E121 (= E125), E124 (≠ Q128), S177 (≠ H174), R178 (≠ D175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T11 (≠ A17), G12 (= G18), Y13 (≠ R19), A14 (≠ W20), N36 (≠ S41), S37 (= S42), N40 (≠ E45), A71 (≠ S75), T72 (= T76), I73 (≠ P77), N74 (≠ P78), H77 (= H81), E94 (= E98), Y95 (≠ K99), E121 (= E125), W161 (vs. gap)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
33% identity, 60% coverage: 64:251/314 of query aligns to 58:258/332 of 2glxA
- active site: K93 (= K99), H179 (= H174)
- binding acetate ion: K93 (= K99), H179 (= H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (= S75), T70 (= T76), N72 (≠ P78), H75 (= H81), E92 (= E98), K93 (= K99), H121 (≠ T127), W161 (vs. gap), R162 (vs. gap)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
30% identity, 40% coverage: 67:192/314 of query aligns to 63:194/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (= H126), Q173 (≠ W171), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: A71 (≠ S75), S72 (≠ T76), P73 (= P77), F76 (≠ S80), Q80 (≠ I84), E94 (= E98), K95 (= K99), P96 (= P100), R161 (vs. gap), P163 (vs. gap), E164 (≠ K162)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
33% identity, 60% coverage: 64:251/314 of query aligns to 59:259/333 of Q2I8V6
- TTNELH 71:76 (≠ TPPASH 76:81) binding
- EK 93:94 (= EK 98:99) binding
- K94 (= K99) mutation to G: Less than 1% remaining activity.
- N120 (≠ E125) binding
- WR 162:163 (vs. gap) binding
- D176 (= D170) mutation to A: Less than 1% remaining activity.
- H180 (= H174) mutation to A: Less than 2% remaining activity.
- G206 (≠ E199) mutation to I: No effect.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
- 283 binding
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
28% identity, 41% coverage: 1:130/314 of query aligns to 3:132/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G18), Y21 (≠ R19), F22 (≠ W20), L42 (≠ A40), D43 (≠ S41), P44 (≠ S42), A77 (≠ S75), T78 (= T76), P79 (= P77), N80 (≠ P78), H83 (= H81), E100 (= E98), K101 (= K99), V129 (≠ T127)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
23% identity, 96% coverage: 12:312/314 of query aligns to 34:358/381 of 1rydA
- active site: K129 (= K99), Y217 (≠ H174)
- binding alpha-D-glucopyranose: Y236 (≠ A193), I254 (≠ E218), Q256 (≠ R220)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ A17), G40 (= G18), K41 (≠ R19), Y42 (≠ W20), S64 (= S41), G65 (≠ S42), K69 (≠ S46), Y87 (≠ A58), L106 (≠ T76), P107 (= P77), N108 (≠ P78), L110 (≠ S80), H111 (= H81), E128 (= E98), K129 (= K99), R157 (≠ T127), A196 (≠ Y160), W199 (vs. gap), R200 (vs. gap), Y217 (≠ H174), Y296 (≠ D250)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
30% identity, 34% coverage: 9:116/314 of query aligns to 4:115/342 of 3ceaA
- active site: K98 (= K99)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G13 (= G18), R14 (= R19), L15 (≠ W20), L38 (= L39), Q42 (≠ N43), V74 (≠ S75), A75 (≠ T76), P76 (= P77), T77 (≠ P78), F79 (≠ S80), H80 (= H81), M83 (≠ I84), E97 (= E98), K98 (= K99)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
23% identity, 96% coverage: 12:312/314 of query aligns to 36:360/383 of 1h6dA
- active site: K131 (= K99), Y219 (≠ H174)
- binding glycerol: K131 (= K99), R202 (vs. gap), D215 (= D170), Y219 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G16), L41 (≠ A17), G42 (= G18), K43 (≠ R19), Y44 (≠ W20), S66 (= S41), G67 (≠ S42), K71 (≠ S46), Y89 (≠ A58), I107 (≠ S75), L108 (≠ T76), P109 (= P77), N110 (≠ P78), H113 (= H81), E130 (= E98), K131 (= K99), R159 (≠ T127), A198 (≠ Y160), W201 (vs. gap), R202 (vs. gap), Y219 (≠ H174), Y298 (≠ D250)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
22% identity, 96% coverage: 12:312/314 of query aligns to 5:317/340 of 1evjA
- active site: K100 (= K99), Y188 (≠ H174)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), L10 (≠ A17), G11 (= G18), K12 (≠ R19), Y13 (≠ W20), D35 (≠ S41), L77 (≠ T76), P78 (= P77), N79 (≠ P78), H82 (= H81), E99 (= E98), K100 (= K99), R128 (≠ T127), W170 (vs. gap), R171 (vs. gap), Y188 (≠ H174), Y267 (≠ W263)
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
29% identity, 40% coverage: 6:132/314 of query aligns to 2:134/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R19), M16 (≠ W20), D37 (≠ S41), P38 (≠ S42), T39 (≠ N43), S42 (= S46), A75 (≠ S75), S76 (≠ T76), P77 (= P77), N78 (≠ P78), H81 (= H81), E100 (= E98), K101 (= K99), E129 (≠ T127)
Sites not aligning to the query:
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
30% identity, 39% coverage: 10:132/314 of query aligns to 4:132/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), H13 (≠ R19), M14 (≠ W20), D35 (≠ S41), P36 (≠ S42), T37 (≠ N43), S40 (= S46), A73 (≠ S75), S74 (≠ T76), P75 (= P77), N76 (≠ P78), H79 (= H81), E98 (= E98), K99 (= K99), E127 (≠ T127)
- binding sulfoquinovose: K99 (= K99), Y128 (≠ Q128)
Sites not aligning to the query:
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
30% identity, 39% coverage: 10:132/314 of query aligns to 2:130/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), H11 (≠ R19), M12 (≠ W20), D33 (≠ S41), P34 (≠ S42), T35 (≠ N43), S38 (= S46), A71 (≠ S75), S72 (≠ T76), P73 (= P77), N74 (≠ P78), H77 (= H81), E96 (= E98), K97 (= K99), E125 (≠ T127)
Sites not aligning to the query:
7bvjA Udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) (see paper)
34% identity, 41% coverage: 68:196/314 of query aligns to 60:186/313 of 7bvjA
Sites not aligning to the query:
- binding (2R,3R)-2,3-bis(oxidanyl)butane-1,4-disulfonic acid: 223, 230, 232
- binding nicotinamide-adenine-dinucleotide: 12, 13, 14, 32, 33, 34, 38
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
35% identity, 31% coverage: 63:159/314 of query aligns to 68:167/349 of 6norA
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
27% identity, 97% coverage: 10:314/314 of query aligns to 2:325/333 of 4koaA
- active site: K94 (= K99), H180 (= H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), A9 (= A17), S10 (≠ G18), T11 (≠ R19), I12 (≠ W20), S33 (= S41), S34 (= S42), R38 (vs. gap), T71 (= T76), N73 (≠ P78), H76 (= H81), K94 (= K99), Q160 (≠ K162)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
26% identity, 71% coverage: 68:290/314 of query aligns to 71:299/332 of B3TMR8
- L79 (≠ T76) binding
- H84 (= H81) binding
- K102 (= K99) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ P166) binding
- D182 (= D170) binding
- Y186 (≠ H174) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
Sites not aligning to the query:
- 17:23 binding
- 42:43 binding
- 63 binding
Query Sequence
>WP_011382585.1 NCBI__GCF_000009985.1:WP_011382585.1
MSIPASSDPVRLALIGAGRWGRNYIRTIAGLPGAALVRLASSNPESHVLAPPGCVVDAHW
RTSIAAPEVEAVIVSTPPASHAEITLAAIAAGKAVLVEKPLTLDLGEADAIARAAREAGA
MVWVEHTQLFNPAWTALKAALTSIGPIRAIRSEAGNHGPYRKGGVPMLWDWGAHDIAQTL
DLMGRDPNRVSAAWAARGEKEGGDSGDVTLTLAFDGIEARIRLCNTMDKARRFAVHGERG
VLLFDDTAADKLTRHPSCPDFGWPAGKGDTLAIDSEMPLARAVRLFAQAVRTPRPGPSPL
DLGLRVVRALAACG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory