SitesBLAST
Comparing WP_011382609.1 NCBI__GCF_000009985.1:WP_011382609.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
34% identity, 64% coverage: 19:182/255 of query aligns to 19:183/249 of 1z0zA
Sites not aligning to the query:
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
34% identity, 64% coverage: 19:182/255 of query aligns to 19:183/249 of 1z0sA
- active site: E96 (≠ P95), C105 (≠ S104)
- binding adenosine-5'-triphosphate: R54 (≠ E49), N115 (= N114), E116 (= E115), A125 (= A126), K126 (= K127), M127 (≠ L128), D145 (= D144), G157 (≠ A156), Y158 (= Y157), S161 (= S160), A180 (≠ S179), F182 (= F181)
- binding pyrophosphate 2-: G48 (= G43), G50 (= G45), T51 (≠ F46), R54 (≠ E49), R72 (≠ S68)
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
34% identity, 64% coverage: 19:182/255 of query aligns to 19:183/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G43), D49 (= D44), G50 (= G45), N115 (= N114), E116 (= E115), A125 (= A126), M127 (≠ L128), R143 (≠ I142), D145 (= D144), T156 (= T155), Y158 (= Y157), S161 (= S160), F182 (= F181)
Sites not aligning to the query:
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
34% identity, 64% coverage: 19:182/255 of query aligns to 19:183/249 of O30297
Sites not aligning to the query:
3afoA Crystal structure of yeast nadh kinase complexed with nadh
32% identity, 70% coverage: 35:212/255 of query aligns to 111:294/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D44), G121 (= G45), L124 (= L48), F148 (= F71), N196 (= N114), D197 (≠ E115), T237 (= T155), A238 (= A156), Y239 (= Y157), S242 (= S160)
Sites not aligning to the query:
6rg8A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/260 of 6rg8A
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[[4-(6-azanyl-9~{H}-purin-8-yl)but-3-ynylamino]methyl]oxolane-3,4-diol: D45 (= D44), G46 (= G45), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
Sites not aligning to the query:
6rbyA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/260 of 6rbyA
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 8a9vA
- binding ~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-2-azanyl-ethanesulfonamide: D45 (= D44), L49 (= L48), L72 (≠ V69), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
Sites not aligning to the query:
7zzjA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 7zzjA
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: D45 (= D44), G46 (= G45), L72 (≠ V69), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
Sites not aligning to the query:
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: 220
7zzgA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 7zzgA
- binding (1~{R},24~{R},25~{S},26~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-25,26-bis(oxidanyl)-27-oxa-2,4,6,9,14,17,20,22-octazatetracyclo[22.2.1.0^{2,10}.0^{3,8}]heptacosa-3(8),4,6,9-tetraen-11-yne-16,21-dione: D45 (= D44), G46 (= G45), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
Sites not aligning to the query:
- binding (1~{R},24~{R},25~{S},26~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-25,26-bis(oxidanyl)-27-oxa-2,4,6,9,14,17,20,22-octazatetracyclo[22.2.1.0^{2,10}.0^{3,8}]heptacosa-3(8),4,6,9-tetraen-11-yne-16,21-dione: 220
7zzeA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 7zzeA
- binding (1~{R},25~{R},26~{S},27~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-26,27-bis(oxidanyl)-28-oxa-2,4,6,9,14,17,21,23-octazatetracyclo[23.2.1.0^{2,10}.0^{3,8}]octacosa-3(8),4,6,9-tetraen-11-yne-16,22-dione: D45 (= D44), G46 (= G45), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), S155 (≠ A152), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
Sites not aligning to the query:
- binding (1~{R},25~{R},26~{S},27~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-26,27-bis(oxidanyl)-28-oxa-2,4,6,9,14,17,21,23-octazatetracyclo[23.2.1.0^{2,10}.0^{3,8}]octacosa-3(8),4,6,9-tetraen-11-yne-16,22-dione: 220
7zzcA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 7zzcA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(2-azanylethylsulfonylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D44), G46 (= G45), L49 (= L48), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
7zzaA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 7zzaA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(3-azanylpropylcarbamoylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D44), G46 (= G45), L49 (= L48), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
6z61A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a di-adenosine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6z61A
- binding (2~{R},3~{R},4~{S},5~{R})-2-[6-azanyl-8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-[6-(2-azanylethylamino)purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol: D45 (= D44), L49 (= L48), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157)
6rr2A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rr2A
6rgfA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with an inhibitor
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rgfA
- binding [(2~{R},3~{R},4~{R},5~{R})-2-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-methyl-amino]prop-1-ynyl]-6-azanyl-purin-9-yl]-5-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] dihydrogen phosphate: D45 (= D44), G46 (= G45), L49 (= L48), H71 (≠ S68), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
6rgbA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rgbA
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynylamino]methyl]oxolane-3,4-diol: D45 (= D44), G46 (= G45), L49 (= L48), F74 (= F71), Y75 (≠ L72), N119 (= N114), E120 (= E115), T158 (= T155), A159 (= A156), Y160 (= Y157), S163 (= S160)
6rc5A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rc5A
6rc4A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rc4A
6rc2A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
28% identity, 67% coverage: 18:187/255 of query aligns to 22:190/261 of 6rc2A
Query Sequence
>WP_011382609.1 NCBI__GCF_000009985.1:WP_011382609.1
MIFSSIAFVAAETEAAKAALARLEQRYPHVDPGEADVIIALGGDGFMLETLHRFVDRRVP
IYGMNRGSVGFLMNVYREHGLIERLSKAEEVILHPLRMKARTASGEEVEALAINEVSLLR
ETRQAAKLRIRIDGKIRMDELICDGILLSTPAGSTAYNLSAHGPIIPLGAGIAALTPISA
FRPRRWRGALLPHTAKVVFEILEAGKRPVSAVADYTEARDVVEVEVREDRTCDLVMLFDP
EHNLEERIITEQFLP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory