Comparing WP_011382615.1 NCBI__GCF_000009985.1:WP_011382615.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
34% identity, 31% coverage: 120:208/290 of query aligns to 866:955/1583 of P07547
Sites not aligning to the query:
P10880 Shikimate kinase 2; SK 2; Shikimate kinase II; SKII; EC 2.7.1.71 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see paper)
26% identity, 48% coverage: 120:259/290 of query aligns to 5:143/173 of P10880
Sites not aligning to the query:
2shkB The three-dimensional structure of shikimate kinase from erwinia chrysanthemi complexed with adp (see paper)
27% identity, 48% coverage: 120:259/290 of query aligns to 5:133/162 of 2shkB
Sites not aligning to the query:
1zyuA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and amppcp at 2.85 angstrom resolution (see paper)
29% identity, 58% coverage: 119:286/290 of query aligns to 3:168/168 of 1zyuA
2iyvA Shikimate kinase from mycobacterium tuberculosis in complex with adp, open lid (conf. B) (see paper)
29% identity, 58% coverage: 119:286/290 of query aligns to 3:168/179 of 2iyvA
4bqsA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with adp and a shikimic acid derivative. (see paper)
29% identity, 58% coverage: 119:286/290 of query aligns to 3:168/169 of 4bqsA
2iyyA Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and so4 (see paper)
29% identity, 58% coverage: 119:286/290 of query aligns to 3:168/169 of 2iyyA
2iywA Shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. B) (see paper)
29% identity, 58% coverage: 119:286/290 of query aligns to 3:168/178 of 2iywA
3bafA Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with amp-pnp
28% identity, 49% coverage: 119:261/290 of query aligns to 3:141/165 of 3bafA
2dfnA Structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and shikimate at 1.9 angstrons of resolution (see paper)
28% identity, 49% coverage: 119:261/290 of query aligns to 3:141/165 of 2dfnA
Sites not aligning to the query:
1we2A Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and shikimic acid (see paper)
28% identity, 49% coverage: 119:261/290 of query aligns to 3:141/165 of 1we2A
1u8aA Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution (see paper)
28% identity, 49% coverage: 119:261/290 of query aligns to 3:139/163 of 1u8aA
Sites not aligning to the query:
1e6cA K15m mutant of shikimate kinase from erwinia chrysanthemi (see paper)
26% identity, 48% coverage: 120:259/290 of query aligns to 5:143/170 of 1e6cA
4y0aA Shikimate kinase from acinetobacter baumannii in complex with shikimate (see paper)
28% identity, 48% coverage: 120:259/290 of query aligns to 11:147/179 of 4y0aA
1shkA The three-dimensional structure of shikimate kinase from erwinia chrysanthemi (see paper)
25% identity, 48% coverage: 120:259/290 of query aligns to 5:128/158 of 1shkA
Sites not aligning to the query:
C1CYP4 HTH-type transcriptional regulator DdrOC from Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115) (see paper)
34% identity, 29% coverage: 13:97/290 of query aligns to 2:96/129 of C1CYP4
Sites not aligning to the query:
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
26% identity, 46% coverage: 79:210/290 of query aligns to 801:937/1555 of 6hqvA
Sites not aligning to the query:
>WP_011382615.1 NCBI__GCF_000009985.1:WP_011382615.1
MVEQAEFAVLARRLGDRVKGFRARRGMSRKDLSSHAGISERYLAQLEGGQANVSVNILWL
LAQAMDTPITELIEAEAEASHPDLPLAKKFLDQLTPDQQSEAYVLLRQNFKRGLKLKRRV
ALIGLRGAGKTTLGEAVAGRFAAPFRRITSMIEQMAGMDMTEILLSTGQKGYRKLEYSAL
ENTLEAQPTMVLEAGGSLVSEPRTFELLLQSCFTIWVQASPEDHMRRVMGQGDLRPIAGQ
QMAAMEDLKAILEARRHLYGRADAVINTSGRSIADSVEEMSRLCAPHLGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory