SitesBLAST
Comparing WP_011382617.1 NCBI__GCF_000009985.1:WP_011382617.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
63% identity, 100% coverage: 2:888/891 of query aligns to 2:912/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (= H32), C34 (= C34), H35 (= H35), G45 (= G45), C47 (= C47), R48 (= R48), C50 (= C50), C64 (= C64)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K253), K339 (= K322), C364 (= C347), C368 (= C351), G402 (= G385), N404 (= N387), N408 (= N391), D431 (= D413), P432 (= P414), R433 (= R415), F447 (= F429), G450 (= G432), D452 (= D434), G525 (= G507), M526 (= M508), G527 (= G509), Q530 (= Q512), H531 (= H513), G563 (= G545), Q564 (= Q546), G630 (= G612), N632 (= N614), S636 (= S618), Q656 (= Q638), D657 (= D639), L658 (≠ I640), T805 (= T781), R807 (= R783), R807 (= R783), V808 (= V784), L809 (= L785), H811 (= H787), W812 (= W788), H813 (= H789), H813 (= H789), T814 (= T790), M817 (= M793), F879 (= F855), N887 (= N863), F903 (≠ L879), K904 (= K880)
- binding iron/sulfur cluster: C145 (= C142), I146 (= I143), Q147 (≠ H144), C148 (= C145), N149 (≠ T146), C151 (= C148), C155 (= C152), N161 (= N158), V163 (= V160), I164 (= I161), V175 (≠ I172), C188 (= C185), V189 (= V186), A190 (≠ G187), C191 (= C188), G192 (= G189), C194 (= C191), C198 (= C195), P199 (= P196), T200 (= T197), A202 (= A199), L203 (= L200), C227 (= C217), C230 (= C220), C234 (= C224), C261 (= C251), K263 (= K253), G264 (= G254), V411 (= V394)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
37% identity, 99% coverage: 2:886/891 of query aligns to 19:925/949 of 6tg9A
- active site: K289 (= K253), C380 (= C351), H381 (= H352), L545 (≠ M508), G582 (= G545), Q583 (= Q546)
- binding fe2/s2 (inorganic) cluster: C51 (= C34), V59 (≠ E44), G60 (= G45), C62 (= C47), C65 (= C50), C79 (= C64)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C220), K289 (= K253), R351 (≠ K322), C352 (≠ G323), C380 (= C351), G414 (= G385), A415 (= A386), D419 (≠ A390), G420 (≠ N391), H421 (= H392), P443 (= P414), R444 (= R415), P464 (≠ N431), N467 (≠ D434), L545 (≠ M508), G546 (= G509), H550 (= H513), G582 (= G545), Q583 (= Q546), Q583 (= Q546), G649 (= G612), E650 (= E613), S655 (= S618), N680 (≠ T643), S693 (= S656), K698 (= K661), D724 (≠ L689), T820 (≠ S780), T821 (= T781), R823 (= R783), R823 (= R783), I824 (≠ V784), L825 (= L785), N829 (≠ H789), V830 (≠ T790), Q833 (≠ M793), N902 (= N863), Y918 (≠ L879), K919 (= K880)
- binding iron/sulfur cluster: H111 (= H96), C115 (vs. gap), C118 (≠ A97), A120 (≠ P99), C124 (≠ S103), C176 (= C142), I177 (= I143), V178 (≠ H144), C179 (= C145), M180 (≠ T146), C182 (= C148), C186 (= C152), I206 (= I172), C218 (= C185), S220 (≠ G187), C221 (= C188), G222 (= G189), C224 (= C191), C228 (= C195), T230 (= T197), A231 (≠ G198), C252 (= C217), Y254 (= Y219), C255 (= C220), V257 (= V222), C259 (= C224), F261 (≠ V226), C287 (= C251), K289 (= K253), V423 (= V394)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
37% identity, 76% coverage: 211:891/891 of query aligns to 2:690/715 of 1fdiA
- active site: C11 (= C220), L41 (= L250), C42 (= C251), K44 (= K253), S108 (= S320), R110 (≠ K322), D134 (= D345), C140 (= C351), H141 (= H352), S180 (≠ N391), M297 (= M508), R333 (= R544), G334 (= G545), Q335 (= Q546)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K253), R110 (≠ K322), G111 (= G323), V139 (≠ L350), C140 (= C351), F173 (≠ I384), G174 (= G385), Y175 (≠ A386), N176 (= N387), D179 (≠ A390), S180 (≠ N391), C201 (≠ L412), D202 (= D413), P203 (= P414), R204 (= R415), L218 (≠ F429), G221 (= G432), N223 (≠ D434), G296 (= G507), M297 (= M508), G298 (= G509), F302 (≠ H513), G334 (= G545), Q335 (= Q546), Q335 (= Q546), G402 (= G612), E403 (= E613), T408 (≠ S618), Q428 (= Q638), D429 (= D639), I430 (= I640), S445 (≠ A655), D478 (= D688), T579 (= T781), V580 (≠ G782), R581 (= R783), R581 (= R783), E582 (≠ V784), H585 (= H787), Y586 (≠ W788), S587 (≠ H789), C588 (≠ T790), Y654 (≠ F855), N662 (= N863), Y678 (≠ L879), K679 (= K880)
- binding nitrite ion: C140 (= C351), H141 (= H352), R333 (= R544), G334 (= G545), V338 (= V549)
- binding iron/sulfur cluster: C8 (= C217), Y10 (= Y219), C11 (= C220), S13 (≠ V222), C15 (= C224), L41 (= L250), C42 (= C251), K44 (= K253), P182 (= P393), I183 (≠ V394)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 76% coverage: 211:891/891 of query aligns to 2:690/715 of P07658
- C8 (= C217) binding
- Y10 (= Y219) binding
- C11 (= C220) binding
- C15 (= C224) binding
- C42 (= C251) binding
- K44 (= K253) binding
- U140 (≠ C351) modified: nonstandard, Selenocysteine
- M297 (= M508) binding
- Q301 (= Q512) binding
- Q335 (= Q546) binding
- S445 (≠ A655) binding
- D478 (= D688) binding
- C588 (≠ T790) binding
- Y654 (≠ F855) binding
- Q655 (≠ C856) binding
- Y678 (≠ L879) binding
- K679 (= K880) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
36% identity, 76% coverage: 211:891/891 of query aligns to 2:672/697 of 2iv2X
- active site: C11 (= C220), L41 (= L250), C42 (= C251), K44 (= K253), S108 (= S320), C140 (= C351), H141 (= H352), S180 (≠ N391), M297 (= M508), R333 (= R544), G334 (= G545), Q335 (= Q546)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (≠ K322), G111 (= G323), T112 (≠ S324), A137 (≠ T348), Q335 (= Q546), G402 (= G612), E403 (= E613), D404 (≠ N614), T408 (≠ S618), A410 (≠ P620), Q428 (= Q638), D429 (= D639), I430 (= I640), S445 (≠ A655), D478 (= D688), C588 (≠ T790), Y660 (≠ L879)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K253), F173 (≠ I384), G174 (= G385), Y175 (≠ A386), N176 (= N387), D179 (≠ A390), S180 (≠ N391), D202 (= D413), P203 (= P414), R204 (= R415), N223 (≠ D434), G296 (= G507), M297 (= M508), F302 (≠ H513), G334 (= G545), R581 (= R783), E582 (≠ V784), V583 (≠ L785), H585 (= H787), Y586 (≠ W788), S587 (≠ H789), K661 (= K880)
- binding iron/sulfur cluster: C8 (= C217), C11 (= C220), S13 (≠ V222), C15 (= C224), L41 (= L250), C42 (= C251), K44 (= K253), G45 (= G254), I183 (≠ V394)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
41% identity, 64% coverage: 210:782/891 of query aligns to 1:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
39% identity, 62% coverage: 208:759/891 of query aligns to 2:541/549 of 7bkbD
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 76% coverage: 208:886/891 of query aligns to 1:717/720 of 2jirA
- active site: K46 (= K253), S106 (= S320), C137 (= C351), M138 (≠ H352), A177 (≠ N391), M305 (= M508), T341 (≠ R544), G342 (= G545), Q343 (= Q546)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ P218), K46 (= K253), Q108 (≠ K322), C137 (= C351), G171 (= G385), S172 (≠ A386), N173 (= N387), E176 (≠ A390), A177 (≠ N391), D201 (= D413), P202 (= P414), R203 (= R415), F217 (= F429), D222 (= D434), C304 (≠ G507), M305 (= M508), G306 (= G509), Q309 (= Q512), R310 (≠ H513), G342 (= G545), Q343 (= Q546), Q343 (= Q546), E413 (≠ G612), T414 (≠ E613), N415 (= N614), T419 (≠ S618), I440 (≠ D639), E441 (≠ I640), A442 (≠ F641), P458 (≠ A655), F460 (≠ S657), S612 (≠ T781), M613 (≠ G782), R614 (= R783), R614 (= R783), I616 (≠ L785), H618 (= H787), W619 (= W788), H620 (= H789), H620 (= H789), T621 (= T790), T623 (≠ S792), F686 (= F855), N694 (= N863), Y710 (≠ L879), K711 (= K880)
- binding nitrite ion: V615 (= V784), F686 (= F855)
- binding iron/sulfur cluster: C10 (= C217), C13 (= C220), T15 (≠ V222), C17 (= C224), L43 (= L250), C44 (= C251), P179 (= P393), V180 (= V394)
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 76% coverage: 208:886/891 of query aligns to 1:717/720 of 2jiqA
- active site: K46 (= K253), S106 (= S320), C137 (= C351), M138 (≠ H352), A177 (≠ N391), M305 (= M508), T341 (≠ R544), G342 (= G545), Q343 (= Q546)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ P218), Q108 (≠ K322), C137 (= C351), G171 (= G385), S172 (≠ A386), E176 (≠ A390), A177 (≠ N391), D201 (= D413), P202 (= P414), R203 (= R415), P219 (≠ N431), D222 (= D434), C304 (≠ G507), M305 (= M508), G306 (= G509), Q309 (= Q512), R310 (≠ H513), G342 (= G545), Q343 (= Q546), Q343 (= Q546), E413 (≠ G612), T414 (≠ E613), N415 (= N614), T419 (≠ S618), I440 (≠ D639), E441 (≠ I640), F443 (≠ L642), P458 (≠ A655), F460 (≠ S657), S612 (≠ T781), M613 (≠ G782), R614 (= R783), R614 (= R783), I616 (≠ L785), H618 (= H787), W619 (= W788), H620 (= H789), H620 (= H789), T621 (= T790), T623 (≠ S792), F686 (= F855), N694 (= N863), Y710 (≠ L879), K711 (= K880)
- binding nitrate ion: M251 (vs. gap), K583 (vs. gap), V589 (≠ K756), W591 (≠ R758), R593 (≠ V760), V704 (= V873)
- binding iron/sulfur cluster: C10 (= C217), C13 (= C220), T15 (≠ V222), C17 (= C224), L43 (= L250), C44 (= C251), V180 (= V394)
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 76% coverage: 208:886/891 of query aligns to 4:720/723 of 2v45A
- active site: K49 (= K253), S109 (= S320), C140 (= C351), M141 (≠ H352), A180 (≠ N391), M308 (= M508), T344 (≠ R544), G345 (= G545), Q346 (= Q546)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ P218), K49 (= K253), Q111 (≠ K322), C140 (= C351), G174 (= G385), N176 (= N387), E179 (≠ A390), A180 (≠ N391), D204 (= D413), P205 (= P414), R206 (= R415), P222 (≠ N431), D225 (= D434), C307 (≠ G507), M308 (= M508), G309 (= G509), Q312 (= Q512), R313 (≠ H513), G345 (= G545), Q346 (= Q546), Q346 (= Q546), E416 (≠ G612), T417 (≠ E613), N418 (= N614), T422 (≠ S618), I443 (≠ D639), E444 (≠ I640), A445 (≠ F641), F446 (≠ L642), P461 (≠ A655), F463 (≠ S657), S615 (≠ T781), M616 (≠ G782), R617 (= R783), R617 (= R783), V618 (= V784), I619 (≠ L785), H621 (= H787), W622 (= W788), H623 (= H789), H623 (= H789), T624 (= T790), T626 (≠ S792), F689 (= F855), N697 (= N863), Y713 (≠ L879), K714 (= K880)
- binding iron/sulfur cluster: C13 (= C217), C16 (= C220), T18 (≠ V222), C20 (= C224), L46 (= L250), C47 (= C251), V183 (= V394)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
30% identity, 76% coverage: 208:886/891 of query aligns to 36:752/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
Q53176 Periplasmic nitrate reductase; EC 1.9.6.1 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
29% identity, 54% coverage: 217:699/891 of query aligns to 48:572/831 of Q53176
- C48 (= C217) binding
- C51 (= C220) binding
- C55 (= C224) binding
- C83 (= C251) binding
- K85 (= K253) binding
- Q152 (≠ K322) binding
- N177 (≠ C347) binding
- C181 (= C351) binding
- 214:221 (vs. 384:391, 25% identical) binding
- GTD 264:266 (= GTD 432:434) binding
- M375 (= M508) binding
- Q379 (= Q512) binding
- N485 (= N614) binding
- SD 511:512 (≠ QD 638:639) binding
- K534 (= K661) binding
- D561 (= D688) binding
Sites not aligning to the query:
- 721:730 binding
- 805 binding
- 822 binding
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
26% identity, 79% coverage: 2:701/891 of query aligns to 4:638/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C34), G45 (= G45), C47 (= C47), R48 (= R48), C50 (= C50), C64 (= C64)
- binding iron/sulfur cluster: F93 (≠ L93), H98 (vs. gap), F99 (vs. gap), C100 (vs. gap), C103 (≠ A97), Q105 (≠ P99), C109 (≠ S103), L141 (≠ M135), R147 (≠ A141), C148 (= C142), L150 (≠ H144), C151 (= C145), Q152 (≠ T146), C154 (= C148), C158 (= C152), C192 (= C185), V193 (= V186), N194 (≠ G187), C195 (= C188), G196 (= G189), A197 (≠ E190), C198 (= C191), C202 (= C195), P203 (= P196), T204 (= T197), G205 (= G198), T206 (≠ A199), I207 (≠ L200), C229 (= C217), C232 (= C220), G235 (= G223), C236 (= C224), L263 (= L250), C264 (= C251), V396 (= V394)
P39185 Periplasmic nitrate reductase; EC 1.9.6.1 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
28% identity, 54% coverage: 217:701/891 of query aligns to 48:574/831 of P39185
- C48 (= C217) binding
- C51 (= C220) binding
- C55 (= C224) binding
- C83 (= C251) binding
- K85 (= K253) binding
- Q152 (≠ K322) binding
- N177 (≠ C347) binding
- C181 (= C351) binding
- 214:221 (vs. 384:391, 25% identical) binding
- STFTH 245:249 (≠ DPRGQ 413:417) binding
- QTD 264:266 (≠ GTD 432:434) binding
- M375 (= M508) binding
- Q379 (= Q512) binding
- N485 (= N614) binding
- SD 511:512 (≠ QD 638:639) binding
- K534 (= K661) binding
- D561 (= D688) binding
Sites not aligning to the query:
- 1:29 signal peptide, Tat-type signal
- 721:730 binding
- 805 binding
- 822 binding
3ml1A Crystal structure of the periplasmic nitrate reductase from cupriavidus necator (see paper)
28% identity, 54% coverage: 217:701/891 of query aligns to 16:542/799 of 3ml1A
- active site: N50 (≠ L250), C51 (= C251), K53 (= K253), G119 (≠ A321), W121 (≠ G323), C149 (= C351), M150 (≠ H352), M343 (= M508), T379 (≠ R544), G380 (= G545), Q381 (= Q546)
- binding heme c: L49 (≠ R249), Y55 (≠ R255)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R17 (≠ P218), K53 (= K253), Q120 (≠ K322), N145 (≠ C347), H148 (≠ L350), C149 (= C351), W182 (≠ I384), G183 (= G385), N185 (= N387), M189 (≠ N391), S213 (≠ D413), T214 (≠ P414), F215 (≠ R415), H217 (≠ Q417), F229 (= F429), D234 (= D434), T342 (≠ G507), M343 (= M508), G344 (= G509), F345 (≠ V510), Q347 (= Q512), G380 (= G545), Q381 (= Q546), Q381 (= Q546), V451 (≠ G612), N452 (≠ E613), N453 (= N614), A457 (≠ S618), S479 (≠ Q638), D480 (= D639), S496 (≠ A655), M498 (≠ S657), K502 (= K661), D529 (= D688)
- binding iron/sulfur cluster: C16 (= C217), C19 (= C220), T21 (≠ V222), C23 (= C224), N50 (≠ L250), C51 (= C251)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 689, 690, 691, 691, 693, 695, 696, 696, 697, 697, 698, 700, 765, 773, 789, 790
1ogyC Crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides (see paper)
29% identity, 54% coverage: 217:699/891 of query aligns to 8:532/789 of 1ogyC
- active site: N42 (≠ L250), C43 (= C251), K45 (= K253), G111 (≠ A321), W113 (≠ G323), C141 (= C351), M142 (≠ H352), M335 (= M508), T371 (≠ R544), G372 (= G545), Q373 (= Q546)
- binding heme c: L41 (≠ R249), N42 (≠ L250), Y47 (≠ R255)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R9 (≠ P218), K45 (= K253), Q112 (≠ K322), N137 (≠ C347), H140 (≠ L350), C141 (= C351), G175 (= G385), N177 (= N387), E180 (≠ A390), M181 (≠ N391), S205 (≠ D413), T206 (≠ P414), H209 (≠ Q417), F221 (= F429), G224 (= G432), D226 (= D434), T334 (≠ G507), M335 (= M508), M335 (= M508), G336 (= G509), F337 (≠ V510), Q339 (= Q512), G372 (= G545), Q373 (= Q546), Q373 (= Q546), V443 (≠ G612), N444 (≠ E613), N445 (= N614), A449 (≠ S618), S471 (≠ Q638), D472 (= D639), A488 (= A655), M490 (≠ S657), D521 (= D688)
- binding molybdenum atom: C141 (= C351), Q373 (= Q546)
- binding iron/sulfur cluster: C8 (= C217), C11 (= C220), C15 (= C224), N42 (≠ L250), C43 (= C251), I184 (≠ V394)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 681, 682, 683, 683, 684, 685, 687, 688, 688, 689, 689, 690, 692, 757, 765, 781, 782, 783
1ogyA Crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides (see paper)
29% identity, 54% coverage: 217:699/891 of query aligns to 8:532/789 of 1ogyA
- active site: N42 (≠ L250), C43 (= C251), K45 (= K253), G111 (≠ A321), W113 (≠ G323), C141 (= C351), M142 (≠ H352), M335 (= M508), T371 (≠ R544), G372 (= G545), Q373 (= Q546)
- binding heme c: L41 (≠ R249), N42 (≠ L250), Y47 (≠ R255)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R9 (≠ P218), K45 (= K253), Q112 (≠ K322), N137 (≠ C347), C141 (= C351), G175 (= G385), N177 (= N387), M181 (≠ N391), S205 (≠ D413), T206 (≠ P414), H209 (≠ Q417), F221 (= F429), G224 (= G432), D226 (= D434), T334 (≠ G507), M335 (= M508), G336 (= G509), F337 (≠ V510), Q339 (= Q512), G372 (= G545), Q373 (= Q546), Q373 (= Q546), V443 (≠ G612), N444 (≠ E613), N445 (= N614), A449 (≠ S618), S471 (≠ Q638), D472 (= D639), A488 (= A655), M490 (≠ S657), D521 (= D688)
- binding iron/sulfur cluster: C8 (= C217), C11 (= C220), C15 (= C224), N42 (≠ L250), C43 (= C251), I184 (≠ V394)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 681, 683, 683, 684, 685, 687, 688, 688, 689, 689, 690, 692, 757, 765, 781, 782, 783
1h0hA Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
24% identity, 55% coverage: 211:699/891 of query aligns to 11:616/977 of 1h0hA
- active site: K56 (= K253), C158 (= C351), H159 (= H352), M371 (= M508), R407 (= R544), G408 (= G545), E409 (≠ Q546)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: A130 (≠ K322), Q154 (≠ C347), I157 (≠ L350), C158 (= C351), M371 (= M508), G516 (= G612), Q517 (≠ E613), N518 (= N614), S522 (= S618), N543 (≠ D639), I544 (= I640), C572 (≠ A655), D605 (= D688)
- binding calcium ion: T358 (≠ A499), K360 (vs. gap), K363 (vs. gap), L393 (≠ C530), G394 (= G531), N395 (≠ H532)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K56 (= K253), C158 (= C351), S193 (≠ A386), N194 (= N387), N198 (= N391), D220 (= D413), P221 (= P414), R222 (= R415), S238 (≠ N431), G239 (= G432), D241 (= D434), A370 (≠ G507), M371 (= M508), W373 (≠ V510), G408 (= G545)
- binding iron/sulfur cluster: C17 (= C217), Y19 (= Y219), C20 (= C220), V22 (= V222), C24 (= C224), L53 (= L250), C54 (= C251), K56 (= K253), G57 (= G254), P200 (= P393), I201 (≠ V394)
Sites not aligning to the query:
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: 854, 856, 862, 863, 866, 936, 951, 967
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 855, 856, 858, 860, 861, 862, 968
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
28% identity, 71% coverage: 131:767/891 of query aligns to 602:1150/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C142), V614 (≠ I143), L615 (≠ H144), C616 (= C145), G617 (≠ T146), C619 (= C148), C623 (= C152), I643 (= I172), C656 (= C185), I657 (≠ V186), S658 (≠ G187), C659 (= C188), G660 (= G189), C662 (= C191), C666 (= C195), G669 (= G198), A670 (= A199), C692 (= C217), Y694 (= Y219), C695 (= C220), C699 (= C224), C725 (= C251), R727 (≠ K253), G728 (= G254), V853 (= V394)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
Q934F5 Formate dehydrogenase subunit alpha; FDH subunit alpha; Formate dehydrogenase large subunit; EC 1.17.1.9 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
24% identity, 55% coverage: 211:699/891 of query aligns to 46:651/1012 of Q934F5
- C52 (= C217) binding
- C55 (= C220) binding
- C59 (= C224) binding
- C89 (= C251) binding
- U193 (≠ C351) binding ; modified: nonstandard, Selenocysteine
Sites not aligning to the query:
- 852 modified: Disulfide link with 879
- 879 modified: Disulfide link with 852
Query Sequence
>WP_011382617.1 NCBI__GCF_000009985.1:WP_011382617.1
MIRFTLDGQEVEAAEGETIWQVSKRLGTTIPHLCHTDRPGFEPEGNCRACVVEIKGERAL
AASCRRRPTPGMVVEAANGRTAKARRMVFELLLADHASPDPDSAFLGWAGALGVTASRFA
PSAAPVRPDTSHPAMAVRLDACIHCTLCLRACREVQVNDVIGMSGRGADSRITFDFAQSM
GASSCVGCGECVQACPTGALLPAAGPVRVERSVDSLCPYCGVGCQVTYHVAGGDIVGAKG
RDGEANHQRLCVKGRFGFDYSRHPQRLTVPLIRKEGAPKEPLDPADPFTHFRPASWDEAL
DAAAAGLKRLPASALAGLGSAKGSNEEAYLFQKLVRTGFKSNNVDHCTRLCHASSVAALL
EGIGSGAVTAPVAEVANAEVIVLIGANPSANHPVAASFIKNAVKGGAQLVILDPRGQALT
RFASHHLKFNNGTDVALLNAMLHVIVAEELYDRDFVQARTTGFAELAQHLKSYAPEAMAP
LCGIDAGTIRVVARLYARAASAMILWGMGVSQHSHGTDNSRCLIALALLCGHVGRPGSGL
HPLRGQNNVQGASDAGLIPMMLPDYGRVGLDAVRQRFEAGWGVELDPDSGLTVVEMMDAA
QAGIIRGLYVEGENPAMSDPDLAHARQALAGLEHLVVQDIFLTETAMLADVVLPASSFFE
KTGSFTNTDRHIQMGRQVIDPPGEARSDLWIITEMGRRLGLPWTYDGPKAVFDEMCGLMG
SLSGITWERLESEGGITTPAGKAILFGDVFPTGDGKARLVPASGLAPAENPDADYPFLLS
TGRVLEHWHTGSMTRRSDVLDRLQGLPAVNVSPGDMARLGLAEGARVRLESRRGAVEAAA
VADSRLSPGALFLPFCFTEAAANLLTNPALDPVAKIPELKVSAVRLLPCSE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory