Comparing WP_011382621.1 NCBI__GCF_000009985.1:WP_011382621.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
32% identity, 39% coverage: 22:236/550 of query aligns to 13:206/707 of 6yswA
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 35% coverage: 42:231/550 of query aligns to 24:202/259 of 5zaiC
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
30% identity, 26% coverage: 67:211/550 of query aligns to 84:222/763 of P40939
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 30% coverage: 13:175/550 of query aligns to 6:150/261 of 5jbxB
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
30% identity, 37% coverage: 8:211/550 of query aligns to 17:206/735 of 8oqsB
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/728 of 8oqrA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
30% identity, 37% coverage: 8:211/550 of query aligns to 13:202/731 of 4b3iA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
30% identity, 37% coverage: 8:211/550 of query aligns to 12:201/730 of 8oquA
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/729 of 8opvA
Sites not aligning to the query:
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
30% identity, 37% coverage: 8:211/550 of query aligns to 11:200/729 of 8opuA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
30% identity, 37% coverage: 8:211/550 of query aligns to 10:199/728 of 8oqlA
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
30% identity, 37% coverage: 8:211/550 of query aligns to 10:199/727 of 8oqoA
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
30% identity, 37% coverage: 8:211/550 of query aligns to 9:198/726 of 8oqvA
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
30% identity, 37% coverage: 8:211/550 of query aligns to 5:194/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
30% identity, 37% coverage: 8:211/550 of query aligns to 5:194/723 of 8oqpA
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
30% identity, 36% coverage: 22:220/550 of query aligns to 10:182/692 of 6iunB
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
30% identity, 36% coverage: 13:211/550 of query aligns to 5:189/711 of 7o4uA
Sites not aligning to the query:
>WP_011382621.1 NCBI__GCF_000009985.1:WP_011382621.1
MINFQTSPESYRHWKLAFDGPVATLTMDVDPASTLAPGYELKMNSYDLGVDIELYDAVQR
LRFEHPEVRAVVMASANPKIFCAGANIKMLGVSSHGHKVNFCKFTNETRNSIEDASENSR
QTYLCAVTGTAAGGGYELALATDYIMMVDDGNTAVSLPEVPLLAVLPGTGGLTRVVDKRK
VRRDLADIFCSIEEGVKGKRAVEWRLVDEVIPSSAFKAAVAKKAAELAARSDRPTAEKGV
VLSQVSRVIGTDSVTYPHIDIAFDRATRAANITIKGPKAACPADLAGIKAQGVDFYPLAL
ARELDDAILHLRANETTIATWVFRTQGDADLVMGYDAALQTFGASDWLVREILLYWKRTM
KRLDVTSRTLFALVEPGSCFAGFVAEILFAVDRSFMLDGTFEDNPAPAAAIRLSALNFDG
LPMGNGISRLATRFLGEPDSVGKARDTIGKDLDAAACAKLGLVTGTPDDIDWEDEIRLMI
EERASFSPDSLTGMEANLRFAGPETMETKIFGRLTAWQNWIFQRPNAVGDQGALKLYGTG
KRAAYNQERV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory