SitesBLAST
Comparing WP_011382623.1 NCBI__GCF_000009985.1:WP_011382623.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b5oA Ferredoxin-NADP reductase
37% identity, 68% coverage: 126:393/393 of query aligns to 5:292/292 of 2b5oA
- active site: Y71 (= Y192), S72 (= S193), C250 (= C351), E290 (= E391), Y292 (= Y393)
- binding flavin-adenine dinucleotide: R69 (= R190), L70 (= L191), Y71 (= Y192), S72 (= S193), C90 (≠ T211), Y96 (vs. gap), G107 (= G218), V108 (= V219), C109 (≠ G220), S110 (= S221), T150 (= T260), E290 (= E391), Y292 (= Y393)
1ewyA Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
35% identity, 68% coverage: 126:393/393 of query aligns to 13:303/303 of 1ewyA
- active site: Y79 (= Y192), S80 (= S193), C261 (= C351), E301 (= E391), Y303 (= Y393)
- binding flavin-adenine dinucleotide: R77 (= R190), L78 (= L191), Y79 (= Y192), S80 (= S193), C98 (≠ T211), L102 (≠ V215), Y104 (vs. gap), G115 (= G218), V116 (= V219), C117 (≠ G220), S118 (= S221), E301 (= E391), Y303 (= Y393)
1gjrA Ferredoxin-NADP+ reductase complexed with NADP+ by cocrystallization (see paper)
35% identity, 68% coverage: 126:393/393 of query aligns to 5:295/295 of 1gjrA
- active site: Y71 (= Y192), S72 (= S193), C253 (= C351), E293 (= E391), Y295 (= Y393)
- binding flavin-adenine dinucleotide: R69 (= R190), L70 (= L191), Y71 (= Y192), S72 (= S193), C90 (≠ T211), L94 (≠ V215), Y96 (vs. gap), G107 (= G218), V108 (= V219), C109 (≠ G220), S110 (= S221), T149 (= T260), E293 (= E391), Y295 (= Y393)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R92 (≠ K213), L94 (≠ V215), T147 (= T258), G148 (= G259), T149 (= T260), P186 (≠ R290), S215 (= S316), R216 (= R317), R225 (≠ K323), Y227 (= Y325), Q229 (= Q327), G254 (= G352), L255 (= L353), Y295 (= Y393)
1queA X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms (see paper)
35% identity, 68% coverage: 126:393/393 of query aligns to 13:303/303 of 1queA
- active site: Y79 (= Y192), S80 (= S193), C261 (= C351), E301 (= E391), Y303 (= Y393)
- binding flavin-adenine dinucleotide: R77 (= R190), L78 (= L191), Y79 (= Y192), S80 (= S193), C98 (≠ T211), L102 (≠ V215), Y104 (vs. gap), K105 (vs. gap), G115 (= G218), V116 (= V219), C117 (≠ G220), S118 (= S221), T157 (= T260), E301 (= E391), Y303 (= Y393)
- binding sulfate ion: S223 (= S316), R224 (= R317), R233 (≠ K323), Y235 (= Y325)
1gawB Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf (see paper)
36% identity, 68% coverage: 126:393/393 of query aligns to 21:305/305 of 1gawB
- active site: Y86 (= Y192), S87 (= S193), C263 (= C351), E303 (= E391), Y305 (= Y393)
- binding flavin-adenine dinucleotide: R84 (= R190), L85 (= L191), Y86 (= Y192), S87 (= S193), C105 (≠ T211), Y111 (vs. gap), G121 (= G218), V122 (= V219), C123 (≠ G220), S124 (= S221), T163 (= T260), Y305 (= Y393)
3vo2A Crystal structure of zea mays leaf ferredoxin-NADP+ reductase iii (see paper)
36% identity, 68% coverage: 126:393/393 of query aligns to 12:296/296 of 3vo2A
- active site: Y77 (= Y192), S78 (= S193), C254 (= C351), E294 (= E391), Y296 (= Y393)
- binding flavin-adenine dinucleotide: R75 (= R190), L76 (= L191), Y77 (= Y192), S78 (= S193), C96 (≠ T211), V97 (= V212), L100 (vs. gap), Y102 (vs. gap), G112 (= G218), V113 (= V219), C114 (≠ G220), S115 (= S221), T154 (= T260), E294 (= E391), Y296 (= Y393)
P10933 Ferredoxin--NADP reductase, leaf isozyme, chloroplastic; FNR; EC 1.18.1.2 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
36% identity, 68% coverage: 126:393/393 of query aligns to 76:360/360 of P10933
- RLYS 139:142 (= RLYS 190:193) binding
- S142 (= S193) binding
- CVK 160:162 (≠ TVK 211:213) binding
- K162 (= K213) binding
- Y166 (vs. gap) binding
- VCS 177:179 (≠ VGS 219:221) binding
- T218 (= T260) binding
- VP 250:251 (≠ AR 289:290) binding
- SR 280:281 (≠ AF 314:315) binding
- K290 (= K323) binding
- GL 319:320 (= GL 352:353) binding
- E358 (= E391) binding
- Y360 (= Y393) mutation to F: Results in a 2.0-fold reduction in kcat for the diaphorase reaction.; mutation to G: Results in a 302-fold reduction in kcat for the diaphorase reaction.; mutation to S: Results in a 22-fold reduction in kcat for the diaphorase reaction.; mutation to W: Results in a 2.2-fold reduction in kcat for the diaphorase reaction.
2vzlA Ferredoxin-NADP reductase (mutations: t155g, a160t, l263p and y303s) complexed with NAD by cocrystallization (see paper)
34% identity, 68% coverage: 126:392/393 of query aligns to 5:294/295 of 2vzlA
- active site: Y71 (= Y192), S72 (= S193), C253 (= C351), E293 (= E391)
- binding flavin-adenine dinucleotide: R69 (= R190), L70 (= L191), Y71 (= Y192), S72 (= S193), C90 (≠ T211), L94 (≠ V215), Y96 (vs. gap), G107 (= G218), V108 (= V219), C109 (≠ G220), S110 (= S221), T149 (= T260), E293 (= E391)
- binding nicotinamide-adenine-dinucleotide: S72 (= S193), R92 (≠ K213), T149 (= T260), C253 (= C351), G254 (= G352), P255 (≠ L353), E293 (= E391)
Sites not aligning to the query:
3mhpA Fnr-recruitment to the thylakoid (see paper)
36% identity, 68% coverage: 126:393/393 of query aligns to 11:295/296 of 3mhpA
- active site: Y76 (= Y192), S77 (= S193), C253 (= C351), E293 (= E391), Y295 (= Y393)
- binding flavin-adenine dinucleotide: R74 (= R190), L75 (= L191), Y76 (= Y192), S77 (= S193), C95 (≠ T211), L99 (vs. gap), G111 (= G218), V112 (= V219), C113 (≠ G220), S114 (= S221), T153 (= T260), E293 (= E391), Y295 (= Y393)
- binding : L25 (≠ G140), T27 (≠ M142), K28 (≠ R143), I29 (= I144), H40 (= H155), F86 (≠ R202), G87 (≠ S203), W163 (≠ E270), F167 (vs. gap), E168 (≠ R272), K169 (≠ R273), E171 (≠ N275), S188 (≠ P292), S189 (≠ E293), E195 (≠ G299), E196 (≠ P300), K199 (= K303), K203 (vs. gap)
1qgaA Pea fnr y308w mutant in complex with NADP+ (see paper)
35% identity, 68% coverage: 126:393/393 of query aligns to 24:308/308 of 1qgaA
- active site: Y89 (= Y192), S90 (= S193), C266 (= C351), E306 (= E391), W308 (≠ Y393)
- binding flavin-adenine dinucleotide: R87 (= R190), L88 (= L191), Y89 (= Y192), S90 (= S193), C108 (≠ T211), L112 (vs. gap), Y114 (vs. gap), G124 (= G218), V125 (= V219), C126 (≠ G220), S127 (= S221), T166 (= T260), W308 (≠ Y393)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S193), K110 (= K213), G165 (= G259), T166 (= T260), G167 (= G261), V198 (≠ A289), P199 (≠ R290), S228 (≠ A314), R229 (≠ F315), K238 (= K323), Y240 (= Y325), Q242 (= Q327), C266 (= C351), G267 (= G352), L268 (= L353), E306 (= E391), W308 (≠ Y393)
1fncA Refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states (see paper)
36% identity, 68% coverage: 126:393/393 of query aligns to 12:296/296 of 1fncA
- active site: Y77 (= Y192), S78 (= S193), C254 (= C351), E294 (= E391), Y296 (= Y393)
- binding adenosine-2'-5'-diphosphate: K98 (= K213), V186 (≠ A289), P187 (≠ R290), S216 (= S316), R217 (= R317), K226 (= K323), Y228 (= Y325), L256 (= L353), G258 (= G355)
- binding dihydroflavine-adenine dinucleotide: R75 (= R190), L76 (= L191), Y77 (= Y192), S78 (= S193), C96 (≠ T211), L100 (≠ V215), Y102 (vs. gap), G112 (= G218), V113 (= V219), C114 (≠ G220), S115 (= S221), T154 (= T260), E294 (= E391), Y296 (= Y393)
P00455 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Spinacia oleracea (Spinach) (see 3 papers)
36% identity, 68% coverage: 126:393/393 of query aligns to 85:369/369 of P00455
- RLYS 148:151 (= RLYS 190:193) binding
- CVK 169:171 (≠ TVK 211:213) binding
- Y175 (vs. gap) binding
- VCS 186:188 (≠ VGS 219:221) binding
- T227 (= T260) binding
- E367 (= E391) mutation to A: Slightly reduced activity.; mutation E->D,Q: Reduced activity.; mutation to L: Reduces activity by 99%.
Sites not aligning to the query:
- 1:55 modified: transit peptide, Chloroplast
1qfzA Pea fnr y308s mutant in complex with NADPH (see paper)
35% identity, 68% coverage: 126:392/393 of query aligns to 24:307/308 of 1qfzA
- active site: Y89 (= Y192), S90 (= S193), C266 (= C351), E306 (= E391)
- binding flavin-adenine dinucleotide: R87 (= R190), L88 (= L191), Y89 (= Y192), S90 (= S193), C108 (≠ T211), K110 (= K213), L112 (vs. gap), Y114 (vs. gap), G124 (= G218), V125 (= V219), C126 (≠ G220), S127 (= S221), T166 (= T260)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (= S193), K110 (= K213), G165 (= G259), T166 (= T260), G167 (= G261), V198 (≠ A289), P199 (≠ R290), S228 (≠ A314), R229 (≠ F315), Y240 (= Y325), C266 (= C351), G267 (= G352), L268 (= L353), G270 (= G355), E306 (= E391)
Sites not aligning to the query:
1qfyA Pea fnr y308s mutant in complex with NADP+ (see paper)
35% identity, 68% coverage: 126:392/393 of query aligns to 24:307/308 of 1qfyA
- active site: Y89 (= Y192), S90 (= S193), C266 (= C351), E306 (= E391)
- binding flavin-adenine dinucleotide: R87 (= R190), L88 (= L191), Y89 (= Y192), S90 (= S193), C108 (≠ T211), L112 (vs. gap), Y114 (vs. gap), G124 (= G218), V125 (= V219), C126 (≠ G220), S127 (= S221), T166 (= T260)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S193), K110 (= K213), G165 (= G259), T166 (= T260), G167 (= G261), V198 (≠ A289), P199 (≠ R290), S228 (≠ A314), R229 (≠ F315), K238 (= K323), Y240 (= Y325), Q242 (= Q327), C266 (= C351), G267 (= G352), L268 (= L353), G270 (= G355), M271 (= M356), E306 (= E391)
Sites not aligning to the query:
1bx0A Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l (see paper)
36% identity, 68% coverage: 126:393/393 of query aligns to 12:296/296 of 1bx0A
- active site: Y77 (= Y192), S78 (= S193), C254 (= C351), L294 (≠ E391), Y296 (= Y393)
- binding flavin-adenine dinucleotide: R75 (= R190), L76 (= L191), Y77 (= Y192), S78 (= S193), C96 (≠ T211), Y102 (vs. gap), G112 (= G218), V113 (= V219), C114 (≠ G220), S115 (= S221), T154 (= T260), Y296 (= Y393)
5h59A Ferredoxin-NADP+ reductase from maize root (see paper)
34% identity, 70% coverage: 119:393/393 of query aligns to 14:311/311 of 5h59A
- active site: Y88 (= Y192), S89 (= S193), F268 (≠ I350), C269 (= C351), E309 (= E391), Y311 (= Y393)
- binding flavin-adenine dinucleotide: R86 (= R190), L87 (= L191), Y88 (= Y192), S89 (= S193), C107 (≠ T211), Y113 (vs. gap), K125 (vs. gap), G127 (= G218), V128 (= V219), C129 (≠ G220), S130 (= S221), T170 (= T260), Y311 (= Y393)
5vw4A Nicotinamide soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 70% coverage: 119:392/393 of query aligns to 12:308/309 of 5vw4A
- active site: Y86 (= Y192), S87 (= S193), F266 (≠ I350), C267 (= C351), E307 (= E391)
- binding flavin-adenine dinucleotide: R84 (= R190), L85 (= L191), Y86 (= Y192), S87 (= S193), C105 (≠ T211), A109 (≠ V215), Y111 (vs. gap), K123 (vs. gap), G125 (= G218), V126 (= V219), C127 (≠ G220), S128 (= S221), T168 (= T260)
- binding nicotinamide: S87 (= S193), T168 (= T260), G169 (= G261), C267 (= C351), G268 (= G352), E307 (= E391), V308 (≠ T392)
Sites not aligning to the query:
5vw2A NADPH soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 70% coverage: 119:392/393 of query aligns to 12:308/309 of 5vw2A
- active site: Y86 (= Y192), S87 (= S193), F266 (≠ I350), C267 (= C351), E307 (= E391)
- binding dihydroflavine-adenine dinucleotide: R84 (= R190), L85 (= L191), Y86 (= Y192), S87 (= S193), C105 (≠ T211), A109 (≠ V215), Y111 (vs. gap), K123 (vs. gap), G125 (= G218), V126 (= V219), C127 (≠ G220), S128 (= S221), T168 (= T260)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S87 (= S193), R107 (≠ K213), T166 (= T258), G167 (= G259), T168 (= T260), G169 (= G261), G199 (= G288), V200 (≠ A289), A201 (≠ R290), S230 (≠ D320), R231 (= R321), K240 (= K323), Y242 (= Y325), Q244 (= Q327), G268 (= G352), L269 (= L353), G271 (= G355), M272 (= M356), E307 (= E391), V308 (≠ T392)
Sites not aligning to the query:
P53991 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Chlamydomonas reinhardtii (Chlamydomonas smithii)
30% identity, 74% coverage: 104:393/393 of query aligns to 42:354/354 of P53991
- K118 (≠ D181) modified: N6,N6,N6-trimethyllysine
- K124 (≠ H187) modified: N6,N6,N6-trimethyllysine
- K170 (≠ G217) modified: N6,N6-dimethyllysine
Sites not aligning to the query:
- 1:35 modified: transit peptide, Chloroplast
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
33% identity, 69% coverage: 122:393/393 of query aligns to 4:306/306 of 2rc6A
- active site: Y90 (= Y192), S91 (= S193), C264 (= C351), E304 (= E391), Y306 (= Y393)
- binding flavin-adenine dinucleotide: R88 (= R190), L89 (= L191), Y90 (= Y192), S91 (= S193), I109 (≠ T211), I110 (≠ V212), D113 (vs. gap), I115 (vs. gap), F122 (≠ A216), G124 (= G218), V125 (= V219), C126 (≠ G220), S127 (= S221), T167 (= T260), E304 (= E391), Y306 (= Y393)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K111 (= K213), T165 (= T258), G166 (= G259), A197 (= A289), P198 (≠ R290), S226 (= S316), R227 (= R317), R237 (≠ K323), Y239 (= Y325), P267 (vs. gap), M270 (= M356)
- binding zinc ion: E181 (≠ R274), H216 (≠ L308)
Query Sequence
>WP_011382623.1 NCBI__GCF_000009985.1:WP_011382623.1
MELKRQHLIDPVVCIRCNTCEEACPVDAITHDGTNYVVSYDKCTGCRTCVSPCPTGAIDN
WLLVDQPWSIDDQFGWEELPLGQTGPGPAEPAPLPPGEVSDLLAAATATTGPSVPPPASA
AKPYFNLYSRDTPVTARVAGNMRITGEGTDSDIHHVVLDFSHNAFPFLEGQSIGIVPPGT
DAKGRAHNIRLYSIASPREGERSGCNNLALTVKRVAGGVGSNYVCDLKKGDEVRVAGPFG
QAFLMPDAPNANIIMICTGTGSAPFRAFTERRRRNAQDASGKLMLFFGARTPEELPYFGP
LMKLPKSLIDVNLAFSRVPDRPKQYVQDKIRERSDDLAALLASADTHVFICGLKGMEQGC
DEAFADICRLHGLDWADLRPRMREEGRYHVETY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory