Comparing WP_011382645.1 NCBI__GCF_000009985.1:WP_011382645.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
53% identity, 91% coverage: 7:248/266 of query aligns to 9:250/270 of D4GSF3
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
48% identity, 97% coverage: 1:258/266 of query aligns to 1:264/271 of Q72J02
Sites not aligning to the query:
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
45% identity, 96% coverage: 3:258/266 of query aligns to 64:321/453 of Q9VLJ8
Sites not aligning to the query:
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
45% identity, 93% coverage: 6:253/266 of query aligns to 64:325/482 of O59954
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
47% identity, 95% coverage: 3:255/266 of query aligns to 55:309/460 of O95396
Sites not aligning to the query:
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
43% identity, 93% coverage: 6:253/266 of query aligns to 42:296/440 of P38820
Sites not aligning to the query:
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 92% coverage: 2:247/266 of query aligns to 3:248/249 of P12282
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
38% identity, 92% coverage: 2:247/266 of query aligns to 2:240/240 of 1jwbB
1jw9B Structure of the native moeb-moad protein complex (see paper)
38% identity, 92% coverage: 2:247/266 of query aligns to 2:240/240 of 1jw9B
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
37% identity, 94% coverage: 3:253/266 of query aligns to 6:276/423 of 6yubA
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
37% identity, 95% coverage: 2:253/266 of query aligns to 6:275/289 of 6yubB
1zfnA Structural analysis of escherichia coli thif (see paper)
40% identity, 92% coverage: 3:247/266 of query aligns to 1:244/244 of 1zfnA
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 92% coverage: 3:247/266 of query aligns to 1:244/251 of P30138
1zud3 Structure of this-thif protein complex (see paper)
38% identity, 92% coverage: 3:247/266 of query aligns to 1:239/240 of 1zud3
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
34% identity, 89% coverage: 2:239/266 of query aligns to 2:217/217 of 1jwaB
O65041 NEDD8-activating enzyme E1 catalytic subunit; RUB-activating enzyme; Ubiquitin-activating enzyme E1-like protein; EC 6.2.1.64 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 59% coverage: 34:189/266 of query aligns to 50:218/454 of O65041
O42939 Ubiquitin-activating enzyme E1-like; Pmt3-activating enzyme subunit 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 59% coverage: 30:187/266 of query aligns to 25:182/628 of O42939
Sites not aligning to the query:
Q19360 NEDD8-activating enzyme E1 catalytic subunit; Ectopic membrane ruffles in embryo protein 1; Ubiquitin-activating enzyme 3 homolog; EC 6.2.1.64 from Caenorhabditis elegans (see paper)
32% identity, 61% coverage: 28:189/266 of query aligns to 40:214/430 of Q19360
Sites not aligning to the query:
P22314 Ubiquitin-like modifier-activating enzyme 1; Protein A1S9; Ubiquitin-activating enzyme E1; EC 6.2.1.45 from Homo sapiens (Human) (see 2 papers)
30% identity, 66% coverage: 25:199/266 of query aligns to 463:645/1058 of P22314
Sites not aligning to the query:
1tt5B Structure of appbp1-uba3-ubc12n26: a unique e1-e2 interaction required for optimal conjugation of the ubiquitin-like protein nedd8 (see paper)
31% identity, 63% coverage: 25:191/266 of query aligns to 35:213/414 of 1tt5B
Sites not aligning to the query:
>WP_011382645.1 NCBI__GCF_000009985.1:WP_011382645.1
MDFTEEQIHRYARHIILPEVGGIGQAKLLGSSALVIGAGGLGSPVILYLAAAGVGTIGVI
DDDDVELSNLQRQIIHRTSNVGAAKVASAAAAVADINPDVKVVPIRARLGKDNARDIFRD
FQVIADGSDNFPTRFLVNDAARLEGKTLVSAAILRFDGQLSTYRPGGPCYRCIYREAPPE
GHVPTCSSAGVLGAIAGTMGAMQATEVIKELLGIGESLAGKLVIYDALSVAFRTVRVPRD
PGCPLCGDHPTITDLSSHGSTANVCG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory