SitesBLAST
Comparing WP_011382702.1 NCBI__GCF_000009985.1:WP_011382702.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 1:242/335 of 5a05A
- active site: K100 (≠ I97), Y185 (≠ H181)
- binding beta-D-glucopyranose: K100 (≠ I97), F159 (= F156), D181 (≠ H177), Y185 (≠ H181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (= G13), Y12 (≠ A14), Y13 (≠ F15), S35 (= S36), G36 (≠ R37), T37 (≠ P38), K40 (= K41), Y58 (≠ A59), I76 (≠ T73), T77 (= T74), P78 (= P75), N79 (≠ T76), L81 (= L78), H82 (= H79), E99 (= E96), K100 (≠ I97), R128 (≠ T125), W167 (= W170), R168 (≠ T171), Y185 (≠ H181)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 1:242/335 of 5a04A
- active site: K100 (≠ I97), Y185 (≠ H181)
- binding beta-D-glucopyranose: K100 (≠ I97), F159 (= F156), R168 (≠ T171), D181 (≠ H177), Y185 (≠ H181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (= G13), Y12 (≠ A14), Y13 (≠ F15), S35 (= S36), G36 (≠ R37), T37 (≠ P38), K40 (= K41), Y58 (≠ A59), I76 (≠ T73), T77 (= T74), P78 (= P75), N79 (≠ T76), L81 (= L78), H82 (= H79), E99 (= E96), K100 (≠ I97), R128 (≠ T125), W167 (= W170), R168 (≠ T171), Y185 (≠ H181)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 1:242/335 of 5a03E
- active site: K100 (≠ I97), Y185 (≠ H181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), L10 (≠ A12), G11 (= G13), Y12 (≠ A14), Y13 (≠ F15), S35 (= S36), G36 (≠ R37), T37 (≠ P38), K40 (= K41), Y58 (≠ A59), I76 (≠ T73), T77 (= T74), P78 (= P75), N79 (≠ T76), H82 (= H79), E99 (= E96), K100 (≠ I97), R128 (≠ T125), W167 (= W170), R168 (≠ T171), Y185 (≠ H181)
- binding beta-D-xylopyranose: K100 (≠ I97), F159 (= F156), R168 (≠ T171), D181 (≠ H177), Y185 (≠ H181), E205 (≠ Q201), T207 (≠ P203), R209 (≠ H205)
- binding alpha-D-xylopyranose: H134 (≠ S131)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 1:242/335 of 5a02A
- active site: K100 (≠ I97), Y185 (≠ H181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ A12), G11 (= G13), Y12 (≠ A14), Y13 (≠ F15), S35 (= S36), G36 (≠ R37), T37 (≠ P38), K40 (= K41), Y58 (≠ A59), I76 (≠ T73), T77 (= T74), P78 (= P75), L81 (= L78), H82 (= H79), E99 (= E96), K100 (≠ I97), R128 (≠ T125), W167 (= W170), R168 (≠ T171), Y185 (≠ H181)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 2:243/336 of 5a06A
- active site: K101 (≠ I97), Y186 (= Y188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ A12), G12 (= G13), Y13 (≠ A14), Y14 (≠ F15), S36 (= S36), G37 (≠ R37), T38 (≠ P38), K41 (= K41), Y59 (≠ A59), I77 (≠ T73), T78 (= T74), P79 (= P75), N80 (≠ T76), L82 (= L78), H83 (= H79), E100 (= E96), K101 (≠ I97), R129 (≠ T125), W168 (= W170), R169 (≠ T171), Y186 (= Y188)
- binding sorbitol: R2 (≠ K3), D72 (= D68), H96 (= H92), K101 (≠ I97), R122 (≠ L118), R122 (≠ L118), L124 (≠ A120), F160 (= F156), R169 (≠ T171), D182 (= D184), Y186 (= Y188)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 72% coverage: 3:233/320 of query aligns to 2:243/336 of 5a03C
- active site: K101 (≠ I97), Y186 (= Y188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), L11 (≠ A12), G12 (= G13), Y13 (≠ A14), Y14 (≠ F15), S36 (= S36), G37 (≠ R37), T38 (≠ P38), K41 (= K41), Y59 (≠ A59), I77 (≠ T73), T78 (= T74), P79 (= P75), N80 (≠ T76), L82 (= L78), H83 (= H79), E100 (= E96), K101 (≠ I97), R129 (≠ T125), W168 (= W170), R169 (≠ T171), Y186 (= Y188)
- binding beta-D-xylopyranose: K101 (≠ I97), F160 (= F156), R169 (≠ T171), D182 (= D184), Y186 (= Y188)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
35% identity, 36% coverage: 28:142/320 of query aligns to 25:139/333 of 4koaA
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
31% identity, 42% coverage: 9:142/320 of query aligns to 6:139/333 of Q2I8V6
- ASTI 9:12 (≠ AGAF 12:15) binding
- S10 (≠ G13) mutation to G: Almost no effect.
- A13 (≠ G16) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S36) mutation to D: No activity.
- ST 33:34 (≠ SR 36:37) binding
- R38 (≠ K41) binding
- TTNELH 71:76 (≠ TPTQLH 74:79) binding
- EK 93:94 (≠ EI 96:97) binding
- K94 (≠ I97) mutation to G: Less than 1% remaining activity.
- N120 (≠ G123) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
31% identity, 42% coverage: 9:142/320 of query aligns to 5:138/332 of 2glxA
- active site: K93 (≠ I97)
- binding acetate ion: K93 (≠ I97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G11), A8 (= A12), S9 (≠ G13), T10 (≠ A14), I11 (≠ F15), S32 (= S36), T33 (≠ R37), R37 (≠ K41), S69 (≠ T73), T70 (= T74), N72 (≠ T76), H75 (= H79), E92 (= E96), K93 (≠ I97), H121 (≠ T125)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
31% identity, 39% coverage: 8:133/320 of query aligns to 35:165/381 of 1rydA
- active site: K129 (≠ I97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ A12), G40 (= G13), K41 (≠ A14), Y42 (≠ F15), S64 (= S36), G65 (≠ R37), K69 (= K41), Y87 (≠ L58), L106 (≠ T74), P107 (= P75), N108 (≠ T76), L110 (= L78), H111 (= H79), E128 (= E96), K129 (≠ I97), R157 (≠ T125)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
31% identity, 39% coverage: 8:133/320 of query aligns to 37:167/383 of 1h6dA
- active site: K131 (≠ I97)
- binding glycerol: K131 (≠ I97)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G11), L41 (≠ A12), G42 (= G13), K43 (≠ A14), Y44 (≠ F15), S66 (= S36), G67 (≠ R37), K71 (= K41), Y89 (≠ L58), I107 (≠ T73), L108 (≠ T74), P109 (= P75), N110 (≠ T76), H113 (= H79), E130 (= E96), K131 (≠ I97), R159 (≠ T125)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
30% identity, 39% coverage: 8:133/320 of query aligns to 6:136/340 of 1evjA
- active site: K100 (≠ I97)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), L10 (≠ A12), G11 (= G13), K12 (≠ A14), Y13 (≠ F15), D35 (≠ S36), L77 (≠ T74), P78 (= P75), N79 (≠ T76), H82 (= H79), E99 (= E96), K100 (≠ I97), R128 (≠ T125)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 59% coverage: 3:191/320 of query aligns to 6:198/347 of 3q2kC
- active site: K100 (≠ I97), H188 (= H181)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ A14), K100 (≠ I97), W159 (≠ F155), T160 (≠ F156), R161 (= R157), Y165 (≠ I161), N184 (≠ H177), Q185 (≠ H178), H188 (= H181)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G13), R17 (≠ A14), I18 (≠ F15), D40 (vs. gap), T41 (≠ S36), A76 (≠ T73), T77 (= T74), S79 (≠ T76), H82 (= H79), Q85 (= Q82), E99 (= E96), K100 (≠ I97), Q128 (≠ T125), W171 (≠ P167), R172 (= R168)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 59% coverage: 3:191/320 of query aligns to 1:193/322 of 3q2kK
- active site: K95 (≠ I97), H183 (= H181)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ A14), K95 (≠ I97), T155 (≠ F156), R156 (= R157), Y160 (≠ I161), N179 (≠ H177), Q180 (≠ H178), H183 (= H181)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G11), G11 (= G13), R12 (≠ A14), I13 (≠ F15), D35 (vs. gap), T36 (≠ S36), T72 (= T74), P73 (= P75), S74 (≠ T76), L76 (= L78), H77 (= H79), E94 (= E96), K95 (≠ I97), Q123 (≠ T125), W166 (≠ P167), R167 (= R168), H183 (= H181)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
37% identity, 32% coverage: 3:105/320 of query aligns to 1:109/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (≠ I97)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (≠ A12), G11 (= G13), F12 (≠ A14), M13 (≠ F15), D40 (≠ S36), M41 (≠ R37), T77 (= T73), T78 (= T74), N80 (≠ T76), H83 (= H79), E100 (= E96), K101 (≠ I97)
Sites not aligning to the query:
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
36% identity, 32% coverage: 5:105/320 of query aligns to 2:108/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (≠ I97)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), T9 (≠ A12), G10 (= G13), F11 (≠ A14), M12 (≠ F15), D39 (≠ S36), M40 (≠ R37), T76 (= T73), T77 (= T74), N79 (≠ T76), H82 (= H79), E99 (= E96), K100 (≠ I97)
Sites not aligning to the query:
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: 129, 157, 159, 172, 185, 189
- binding nicotinamide-adenine-dinucleotide: 128, 172, 189
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
36% identity, 32% coverage: 5:105/320 of query aligns to 2:108/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (≠ I97)
- binding nicotinamide-adenine-dinucleotide: T9 (≠ A12), G10 (= G13), F11 (≠ A14), M12 (≠ F15), D39 (≠ S36), M40 (≠ R37), T76 (= T73), T77 (= T74), P78 (= P75), N79 (≠ T76), H82 (= H79), E99 (= E96), K100 (≠ I97)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 129, 157, 159, 172, 185, 189
- binding nicotinamide-adenine-dinucleotide: 128, 189
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
30% identity, 41% coverage: 4:135/320 of query aligns to 1:136/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (≠ A14), M12 (≠ F15), D33 (≠ S36), L34 (≠ R37), T70 (= T73), T71 (= T74), P72 (= P75), N73 (≠ T76), L75 (= L78), H76 (= H79), Q79 (= Q82), E93 (= E96), K94 (≠ I97), N122 (vs. gap)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
30% identity, 41% coverage: 4:135/320 of query aligns to 1:136/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ A14)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G13), F11 (≠ A14), M12 (≠ F15), D33 (≠ S36), L34 (≠ R37), T70 (= T73), T71 (= T74), P72 (= P75), N73 (≠ T76), L75 (= L78), H76 (= H79), Q79 (= Q82), E93 (= E96), K94 (≠ I97), N122 (vs. gap)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 152, 154, 175, 176, 179, 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 161, 179, 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
30% identity, 41% coverage: 4:135/320 of query aligns to 1:136/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ A14)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G11), G10 (= G13), F11 (≠ A14), M12 (≠ F15), D33 (≠ S36), L34 (≠ R37), T70 (= T73), T71 (= T74), P72 (= P75), N73 (≠ T76), L75 (= L78), H76 (= H79), Q79 (= Q82), E93 (= E96), K94 (≠ I97), N122 (vs. gap)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 154, 175, 179, 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 161, 290
Query Sequence
>WP_011382702.1 NCBI__GCF_000009985.1:WP_011382702.1
MSKPVNIALIGAGAFGVKHLDALSVIDGAQVVSLVSRPEDKPEEIAAKYGIPHVAHDLAE
SLALPHVDAVILTTPTQLHASQAMACLKAGKHVMVEIPMADNLADAEALVALQKKTGLVA
MCGHTRRFNPSHQWVHNKITGGGFNIQQMDVQTYFFRRTNINALGQPRCWTDHLLWHHAA
HTVDLFAYQTGGEIVAANVLQGPIHPDLGIAMDMSIQLKSSTGAICTLSLSFNNEGPLGT
FFRYIGDSGTYIARYDDLFDGKDQPIDVTKVDVSMNGIELQDREFLAAIREGREPNASVA
KVLPCYRTLHALEQQLKQAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory