Comparing WP_011382725.1 NCBI__GCF_000009985.1:WP_011382725.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x40A Structure of a cbio dimer bound with amppcp (see paper)
66% identity, 96% coverage: 2:254/264 of query aligns to 4:256/280 of 5x40A
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 95% coverage: 7:256/264 of query aligns to 7:263/280 of Q5M244
5d3mA Folate ecf transporter: amppnp bound state (see paper)
36% identity, 92% coverage: 2:245/264 of query aligns to 5:250/280 of 5d3mA
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
36% identity, 92% coverage: 2:245/264 of query aligns to 5:247/278 of 8bmpA
8bmpB Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
38% identity, 89% coverage: 7:240/264 of query aligns to 6:246/281 of 8bmpB
5d3mB Folate ecf transporter: amppnp bound state (see paper)
38% identity, 89% coverage: 7:240/264 of query aligns to 6:246/281 of 5d3mB
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
36% identity, 86% coverage: 18:245/264 of query aligns to 19:247/278 of 8bmsA
Sites not aligning to the query:
8bmsB Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
38% identity, 89% coverage: 7:240/264 of query aligns to 6:246/281 of 8bmsB
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 96% coverage: 2:254/264 of query aligns to 1:253/276 of Q5M243
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 83% coverage: 9:226/264 of query aligns to 7:224/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 83% coverage: 10:227/264 of query aligns to 9:225/241 of 4u00A
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
33% identity, 81% coverage: 13:227/264 of query aligns to 17:225/263 of 4zirA
Sites not aligning to the query:
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 81% coverage: 13:227/264 of query aligns to 17:227/265 of 4hluA
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
38% identity, 75% coverage: 3:199/264 of query aligns to 5:194/249 of 4hluC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 84% coverage: 15:237/264 of query aligns to 29:247/378 of P69874
Sites not aligning to the query:
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
38% identity, 75% coverage: 3:199/264 of query aligns to 4:190/247 of 4zirB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 80% coverage: 16:227/264 of query aligns to 18:230/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 80% coverage: 16:227/264 of query aligns to 19:231/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 80% coverage: 16:227/264 of query aligns to 19:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 80% coverage: 16:227/264 of query aligns to 19:231/344 of 3tuiC
Sites not aligning to the query:
>WP_011382725.1 NCBI__GCF_000009985.1:WP_011382725.1
MILEAAGLTYRYPGGVAALSGLDLGVERGRRLAVLGPNGAGKTTLLLHLNGTLKPSAGTV
RLGGEIMGYSRAALTGWRRRVGLVLQEPDDQLFAATVAEDVSFGPLNLGLSEAETRRRVE
AALDALGISDLAGRATHMLSFGQKKRVAIAGALAMEPEVLLLDEPLAGLDHQGGKRLLAA
LDALARAGTTLVFTTHEVDLAHGFADRVALFRDGRVIAQGEAAEVLSDRECLAACGLEMP
LLLELGVRTRDEALALLAVGRKVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory