SitesBLAST
Comparing WP_011382728.1 NCBI__GCF_000009985.1:WP_011382728.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m4rA Structure of the n-terminal class ii aldolase domain of a conserved protein from thermoplasma acidophilum
40% identity, 31% coverage: 15:225/679 of query aligns to 4:210/213 of 3m4rA
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
35% identity, 36% coverage: 426:672/679 of query aligns to 1:245/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G437), S15 (= S440), G16 (= G441), I17 (= I442), D36 (= D461), I37 (≠ R462), Q38 (≠ D463), C58 (= C483), D59 (= D484), V60 (= V485), N86 (= N511), A87 (= A512), V90 (≠ A515), I110 (≠ L534), T137 (≠ N562), Y152 (= Y577), K156 (= K581), V185 (≠ I610)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (≠ Q517), N94 (≠ G518), S95 (≠ A519), D98 (≠ E522)
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
33% identity, 37% coverage: 428:675/679 of query aligns to 5:261/263 of 3ai2A
- active site: G18 (= G441), S144 (= S564), Y157 (= Y577), K161 (= K581)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G437), S16 (≠ G439), S17 (= S440), G18 (= G441), I19 (= I442), A38 (≠ D461), R39 (= R462), Q40 (≠ D463), V64 (≠ C483), D65 (= D484), V66 (= V485), N92 (= N511), G94 (= G513), N142 (= N562), Y157 (= Y577), K161 (= K581), P187 (≠ A607), I190 (= I610), T192 (= T616), W195 (≠ M619)
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
33% identity, 37% coverage: 428:675/679 of query aligns to 5:261/263 of 3ai3C
- active site: G18 (= G441), S144 (= S564), Y157 (= Y577), K161 (= K581)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G437), S16 (≠ G439), S17 (= S440), G18 (= G441), I19 (= I442), A38 (≠ D461), R39 (= R462), Q40 (≠ D463), R43 (≠ A466), D65 (= D484), V66 (= V485), N92 (= N511), G94 (= G513), N142 (= N562), Y157 (= Y577), K161 (= K581), P187 (≠ A607), G188 (≠ D608), I190 (= I610), T192 (= T616), W195 (≠ M619)
- binding alpha-L-sorbopyranose: A252 (≠ T666), F254 (≠ T668)
- binding L-sorbose: G96 (≠ A515), E154 (≠ F574), Y157 (= Y577), W195 (≠ M619)
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
33% identity, 37% coverage: 428:675/679 of query aligns to 5:261/263 of 3ai3A
- active site: G18 (= G441), S144 (= S564), Y157 (= Y577), K161 (= K581)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G437), S16 (≠ G439), S17 (= S440), G18 (= G441), I19 (= I442), A38 (≠ D461), R39 (= R462), Q40 (≠ D463), R43 (≠ A466), V64 (≠ C483), D65 (= D484), V66 (= V485), N92 (= N511), G94 (= G513), N142 (= N562), S144 (= S564), Y157 (= Y577), K161 (= K581), P187 (≠ A607), G188 (≠ D608), I190 (= I610), T192 (= T616), W195 (≠ M619)
- binding L-sorbose: G96 (≠ A515), S144 (= S564), L151 (≠ G571), E154 (≠ F574), Y157 (= Y577), G188 (≠ D608)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
32% identity, 36% coverage: 428:672/679 of query aligns to 3:240/244 of 7krmC
- active site: G18 (= G441), S140 (= S564), Y155 (= Y577)
- binding nicotinamide-adenine-dinucleotide: G12 (= G437), S15 (= S440), G18 (= G441), I19 (= I442), D38 (= D461), L39 (≠ R462), A60 (≠ C483), N61 (≠ D484), V62 (= V485), N88 (= N511), V111 (≠ L534), S140 (= S564), Y155 (= Y577), K159 (= K581), I188 (≠ L615), T190 (≠ D617)
A0A3Q8GL18 (+)-cis,trans-nepetalactol synthase NEPS1; Nepetalactol-related short-chain dehydrogenase; Nepetalactol dehydrogenase; Nepetalactol-related short-chain reductase 1; Nepetalactol-related SDR1; NmNEPS1; EC 5.5.1.34; EC 1.1.1.419 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
29% identity, 37% coverage: 422:672/679 of query aligns to 9:261/271 of A0A3Q8GL18
- N125 (= N535) mutation to A: Strongly reduced cis-trans-nepetalactone levels.
- T152 (≠ N562) mutation to N: Absence of cis-trans-nepetalactone.
- T153 (≠ A563) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T154 (≠ S564) mutation to G: Loss of dehydrogenase activity and strongly enhanced cis-trans-nepetalactol levels associated with a huge increase in Km for cis-trans-nepetalactol.
- P155 (≠ K565) mutation to S: Strongly reduced cis-trans-nepetalactone levels.
- L156 (≠ Q566) mutation to S: Reduced dehydrogenase activity and absence of cis-trans-nepetalactone.
- Y167 (= Y577) mutation to F: Absence of cis-trans-nepetalactone.
- K171 (= K581) mutation to M: Absence of cis-trans-nepetalactone.
- S198 (≠ D608) mutation to M: Absence of cis-trans-nepetalactone.
- V199 (≠ R609) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T202 (vs. gap) mutation to A: Absence of cis-trans-nepetalactone.
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
33% identity, 37% coverage: 426:673/679 of query aligns to 2:254/257 of 6pejA
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
30% identity, 36% coverage: 428:672/679 of query aligns to 3:255/267 of F1SWA0
- S142 (= S564) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ Q566) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (≠ L579) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K581) mutation to A: Abolishes all oxidoreductase activity.
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
29% identity, 34% coverage: 425:657/679 of query aligns to 5:244/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G437), S20 (= S440), G21 (= G441), I22 (= I442), D41 (= D461), I42 (≠ R462), M66 (≠ C483), D67 (= D484), V68 (= V485), N94 (= N511), A95 (= A512), G96 (= G513), M145 (≠ N562), S147 (= S564), Y160 (= Y577), K164 (= K581), P190 (≠ A607), F192 (≠ R609), V193 (≠ I610), T195 (≠ S612), L197 (= L614), V198 (≠ L615)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A515), S147 (= S564), H149 (≠ Q566), K157 (≠ F574), Y160 (= Y577), F192 (≠ R609), Q201 (≠ M619)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
29% identity, 34% coverage: 425:657/679 of query aligns to 5:244/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A515), H149 (≠ Q566), K157 (≠ F574), F192 (≠ R609), Q201 (≠ M619)
- binding nicotinamide-adenine-dinucleotide: G17 (= G437), S20 (= S440), G21 (= G441), I22 (= I442), D41 (= D461), I42 (≠ R462), M66 (≠ C483), D67 (= D484), V68 (= V485), N94 (= N511), A95 (= A512), G96 (= G513), M145 (≠ N562), Y160 (= Y577), K164 (= K581), P190 (≠ A607), F192 (≠ R609), V193 (≠ I610), T195 (≠ S612), L197 (= L614), V198 (≠ L615)
7qujA Structure of nsneps2, a 7s-cis-trans nepetalactone synthase (see paper)
31% identity, 37% coverage: 425:672/679 of query aligns to 1:254/259 of 7qujA
- binding nicotinamide-adenine-dinucleotide: G13 (= G437), S16 (= S440), G17 (= G441), I18 (= I442), D38 (= D461), I39 (≠ R462), Q40 (≠ D463), C61 (= C483), D62 (= D484), I63 (≠ V485), N89 (= N511), A90 (= A512), G91 (= G513), T145 (≠ N562), S146 (≠ A563), Y160 (= Y577), K164 (= K581), P190 (≠ A607), M191 (≠ D608), A192 (≠ R609), V193 (≠ I610), T195 (≠ S612), L197 (= L614), T198 (≠ I620)
6f9qC Binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with NAD+ (see paper)
30% identity, 37% coverage: 425:672/679 of query aligns to 3:253/260 of 6f9qC
- active site: G19 (= G441), Y159 (= Y577)
- binding nicotinamide-adenine-dinucleotide: G15 (= G437), S18 (= S440), G19 (= G441), I20 (= I442), D40 (= D461), I41 (≠ R462), Q42 (≠ D463), C63 (= C483), D64 (= D484), V65 (= V485), N91 (= N511), A92 (= A512), G93 (= G513), N144 (= N562), Y159 (= Y577), K163 (= K581), P189 (≠ A607), M190 (≠ D608), V192 (≠ I610), T194 (≠ S612), P195 (≠ G613), L196 (= L614), T197 (≠ L615)
A0A3Q8GLE8 (+)-cis,cis-nepetalactol synthase NEPS3; Nepetalactol-related short-chain reductase 3; NmNEPS3; EC 5.5.1.35 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
30% identity, 37% coverage: 425:672/679 of query aligns to 9:259/270 of A0A3Q8GLE8
- 21:27 (vs. 437:443, 86% identical) binding
- DIQ 46:48 (≠ DRD 461:463) binding
- DV 70:71 (= DV 484:485) binding
- N97 (= N511) binding
- N150 (= N562) mutation to T: No effect on catalytic activity.
- S154 (≠ Q566) mutation to L: Abolishes catalytic activity.
- YVMSK 165:169 (≠ YGLPK 577:581) binding
- K169 (= K581) mutation to M: Abolishes catalytic activity.
- M196 (≠ D608) mutation to S: Abolishes catalytic activity.
- VATPL 198:202 (≠ IRSGL 610:614) binding
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
35% identity, 36% coverage: 430:672/679 of query aligns to 4:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G437), S13 (≠ G439), R14 (≠ S440), G15 (= G441), I16 (= I442), L36 (vs. gap), R37 (≠ L460), N38 (≠ D461), A61 (≠ C483), D62 (= D484), V63 (= V485), N89 (= N511), A90 (= A512), G91 (= G513), T113 (≠ L534), V143 (≠ A563), S145 (≠ K565), Y159 (= Y577), K163 (= K581), P189 (≠ S612), G190 (= G613), I192 (≠ L615), T194 (≠ D618), I196 (= I620), H197 (≠ K621)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
32% identity, 36% coverage: 428:674/679 of query aligns to 8:252/262 of 3pk0B
8ijgC Crystal structure of alcohol dehydrogenase m5 from burkholderia gladioli with NADP
29% identity, 37% coverage: 426:675/679 of query aligns to 2:249/250 of 8ijgC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G437), T15 (≠ G439), S16 (= S440), I18 (= I442), R38 (= R462), R39 (≠ D463), D60 (= D484), V61 (= V485), N87 (= N511), G89 (= G513), R110 (≠ L534), N135 (= N562), A137 (≠ S564), Y150 (= Y577), K154 (= K581), P180 (≠ A607), G181 (≠ D608), T183 (≠ I610), T185 (≠ S612), G187 (≠ L614)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
31% identity, 35% coverage: 434:672/679 of query aligns to 11:254/258 of 3ak4A
- active site: G18 (= G441), S141 (= S564), L151 (≠ F574), Y154 (= Y577), K158 (= K581), E199 (≠ R623)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S440), G18 (= G441), I19 (= I442), D38 (= D461), L39 (≠ R462), V60 (≠ C483), D61 (= D484), V62 (= V485), N88 (= N511), A89 (= A512), G90 (= G513), T139 (≠ N562), S141 (= S564), Y154 (= Y577), K158 (= K581), G185 (≠ D608), V187 (≠ I610), T189 (≠ S612), M191 (≠ L614)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
32% identity, 36% coverage: 430:674/679 of query aligns to 1:253/255 of 3wyeA
- active site: G12 (= G441), S138 (= S564), Y151 (= Y577), K155 (= K581), L196 (≠ M619)
- binding nicotinamide-adenine-dinucleotide: G8 (= G437), Q11 (≠ S440), G12 (= G441), I13 (= I442), D32 (= D461), Y33 (≠ R462), V57 (≠ C483), D58 (= D484), V59 (= V485), N85 (= N511), A86 (= A512), S138 (= S564), Y151 (= Y577), K155 (= K581), P181 (≠ A607), G182 (≠ D608), V184 (≠ I610), T186 (≠ S612), M188 (≠ L614), W189 (vs. gap)
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
33% identity, 36% coverage: 432:675/679 of query aligns to 9:248/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: G14 (= G437), I19 (= I442), D38 (= D461), L39 (vs. gap), C63 (= C483), N64 (≠ D484), V65 (= V485), N91 (= N511), A92 (= A512), G93 (= G513), I140 (≠ N562), S141 (≠ A563), Y155 (= Y577), K159 (= K581), P185 (≠ A607), G186 (≠ D608)
Query Sequence
>WP_011382728.1 NCBI__GCF_000009985.1:WP_011382728.1
MKSLWSDADAESFVTRYAPEGVNRDLALRVYTTRLLGGDPRLVLHGGGNTSCKTTVTDLL
GETVEVLCVKGSGWDMGDIEPAGLPAVRLAPLLKLRRLDSLSDEDMVDYQRGNLMNSASP
NPSVETLLHGFLPHKFIDHTHSTAVLSLVDQPDGEALAREVYGTRMGYVPYIMPGFALAK
KAAEIYEQDPTVEGLILVKHGIFTFADNARTAYELMIEMVTLAEQRLEKGRKPLVAATGL
PKDPAPLAEVAPILRGLLANGPKRRILDFRTSNAIRAYVDGAEIGRYSQQGVVTPDHTIR
TKNWPVVLPAPEAGKTAEWAEAAQAAIESFEAKYHAYFSRNNQRLGNIKTELDPKPCVAL
VPGLGLFGIGASAKDAAIAADIAVNTVESITDAEAIGRFEPVGEADLFDLEYWSLEQAKL
GKAAEKPLARQVVVVTGGGSGIGAATAKAFAKEGAEVAVLDRDADAAAKAAKACGGKALG
IACDVTDPASVRAAFDRVAERFGGVDVVVSNAGAAWQGAVGEVDDSTLRASFELNFFGHQ
AVAQNAVRVFKAQGTGGALLFNASKQAVNPGKNFGPYGLPKAATLFLMKQYALDHGKDGI
RSNAVNADRIRSGLLTDDMIKSRSSARGLSEQDYMGGNLLGREVTAEDVADAFVWLAKAS
KVTACTVTVDGGNIEASLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory