SitesBLAST
Comparing WP_011382764.1 NCBI__GCF_000009985.1:WP_011382764.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
51% identity, 96% coverage: 7:300/305 of query aligns to 4:306/315 of Q51742
- W22 (≠ R25) mutation to A: Decreased heat stability.
- E26 (≠ D29) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ A33) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (vs. gap) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (≠ L224) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ D235) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E272) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
46% identity, 96% coverage: 11:304/305 of query aligns to 2:302/304 of 8qeuA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7nouA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D226), C265 (= C264), R293 (= R292)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I52), T52 (= T58), R53 (= R59), R53 (= R59), F56 (≠ V62), F56 (≠ V62), L79 (= L85), D82 (≠ G88), E83 (= E89), V91 (= V97), Y95 (≠ F101), L266 (= L265), R293 (= R292)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7nnyA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D226), C265 (= C264), R293 (= R292)
- binding 1-naphthol: T52 (= T58), R53 (= R59), F56 (≠ V62), E83 (= E89), V91 (= V97), Y95 (≠ F101)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7nnwA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D226), C265 (= C264), R293 (= R292)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I52), T52 (= T58), R53 (= R59), F56 (≠ V62), L79 (= L85), L92 (= L98), Y95 (≠ F101)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
47% identity, 96% coverage: 11:304/305 of query aligns to 4:305/308 of 7nnvA
- active site: R102 (= R108), H129 (= H135), Q132 (= Q138), D225 (= D226), C265 (= C264), R293 (= R292)
- binding phosphoric acid mono(formamide)ester: S51 (= S57), T52 (= T58), R53 (= R59), T54 (= T60), R102 (= R108), H129 (= H135), C265 (= C264), L266 (= L265), R293 (= R292)
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
47% identity, 96% coverage: 11:304/305 of query aligns to 3:304/307 of 2i6uA
- active site: R52 (= R59), T53 (= T60), R80 (= R87), R101 (= R108), H128 (= H135), Q131 (= Q138), D224 (= D226), C264 (= C264), R292 (= R292)
- binding phosphoric acid mono(formamide)ester: S50 (= S57), T51 (= T58), R52 (= R59), T53 (= T60), R101 (= R108), C264 (= C264), L265 (= L265), R292 (= R292)
- binding norvaline: L123 (= L130), N160 (= N166), D224 (= D226), S228 (= S230), M229 (= M231)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
47% identity, 96% coverage: 11:304/305 of query aligns to 3:304/307 of P9WIT9
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
45% identity, 96% coverage: 11:304/305 of query aligns to 2:295/297 of 8qevA
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
43% identity, 95% coverage: 11:300/305 of query aligns to 12:305/316 of Q81M99
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
46% identity, 96% coverage: 11:304/305 of query aligns to 4:302/305 of 7np0A
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
46% identity, 96% coverage: 11:304/305 of query aligns to 3:294/297 of 7nnzB
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
42% identity, 95% coverage: 11:300/305 of query aligns to 8:301/307 of 4nf2A
- active site: R55 (= R59), T56 (= T60), R83 (= R87), R104 (= R108), H131 (= H135), Q134 (= Q138), D226 (= D226), C265 (= C264), R293 (= R292)
- binding phosphoric acid mono(formamide)ester: S53 (= S57), T54 (= T58), R55 (= R59), T56 (= T60), R104 (= R108), H131 (= H135), Q134 (= Q138), C265 (= C264), L266 (= L265), R293 (= R292)
- binding norvaline: L126 (= L130), N162 (= N166), D226 (= D226), S230 (= S230), M231 (= M231)
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
45% identity, 96% coverage: 11:304/305 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R108), H123 (= H135), Q126 (= Q138), D219 (= D226), C259 (= C264), R287 (= R292)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R59), F56 (≠ V62), E77 (= E89), V85 (= V97), Y89 (≠ F101), L260 (= L265), A284 (= A289), R287 (= R292)
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
42% identity, 95% coverage: 2:292/305 of query aligns to 33:330/354 of P00480
- G39 (= G8) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R11) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L14) to F: in dbSNP:rs72554309
- K46 (≠ D17) to R: in dbSNP:rs1800321
- Y55 (≠ H26) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L30) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K55) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 57:60) binding
- G100 (= G67) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M68) to L: in dbSNP:rs1133135
- L111 (= L78) to P: in dbSNP:rs1800324
- T125 (≠ A92) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D93) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (= R96) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I107) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R108) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H135) binding
- Q171 (= Q138) binding
- I172 (≠ V139) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ V143) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TF 145:146) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ R150) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G155) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G162) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D163) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A168) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ A174) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ G176) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (≠ C180) to K: in OTCD; late onset
- H214 (≠ E181) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P187) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P192) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V207) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T225) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (= T227) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W228) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G232) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (≠ C233) to R: in dbSNP:rs1800328
- E272 (≠ D235) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (≠ E240) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H263) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C264) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 264:265) binding
- E309 (= E271) natural variant: Missing (in OTCD; late onset)
- R330 (= R292) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 333 natural variant: T -> A
- 340 S → P: in OTCD; late onset; dbSNP:rs72558489
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
42% identity, 92% coverage: 11:292/305 of query aligns to 7:297/321 of 1othA
- active site: R59 (= R59), T60 (= T60), V87 (≠ R87), R108 (= R108), H135 (= H135), Q138 (= Q138), D230 (= D226), C270 (= C264), R297 (= R292)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S57), T58 (= T58), R59 (= R59), T60 (= T60), R108 (= R108), L130 (= L130), H135 (= H135), N166 (= N166), D230 (= D226), S234 (= S230), M235 (= M231), C270 (= C264), L271 (= L265), R297 (= R292)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
42% identity, 92% coverage: 11:292/305 of query aligns to 7:297/321 of 1c9yA
- active site: R59 (= R59), T60 (= T60), V87 (≠ R87), R108 (= R108), H135 (= H135), Q138 (= Q138), D230 (= D226), C270 (= C264), R297 (= R292)
- binding phosphoric acid mono(formamide)ester: S57 (= S57), T58 (= T58), R59 (= R59), T60 (= T60), R108 (= R108), C270 (= C264), L271 (= L265), R297 (= R292)
- binding norvaline: L130 (= L130), N166 (= N166), D230 (= D226), S234 (= S230), M235 (= M231)
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
42% identity, 92% coverage: 11:292/305 of query aligns to 40:330/354 of P00481
- R92 (= R59) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C264) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
Query Sequence
>WP_011382764.1 NCBI__GCF_000009985.1:WP_011382764.1
MNSVNASGAPRHFLDLDGFDTATLRHILDLGLAYKQGKGPKAPLAGKMLAMIFEKPSTRT
RVSFEVGMKQLGGDVIMLAAGDTQLGRGETIADTARVLSRFVDAVMIRTNLPEKLTELAK
YADVPVINGLTDQSHPCQVMADVMTFEEHRGSLKGKVVAWVGDGNNVAASWIHAAGHFGC
EIRLACPDSLMPSRAAVDWARAKGASVVLTTHPAEAVAGAHLVLTDTWVSMGCQDSNRHE
LLEPYQVNEALMAKAAPDALFMHCLPAHRGEEVTDPVMDGIQSVVWDEAENRMHVQKGIL
TWCLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory