Comparing WP_011382778.1 NCBI__GCF_000009985.1:WP_011382778.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
44% identity, 91% coverage: 8:258/275 of query aligns to 5:258/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
44% identity, 91% coverage: 8:258/275 of query aligns to 5:258/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
46% identity, 88% coverage: 8:248/275 of query aligns to 3:243/253 of 6z5uK
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
43% identity, 87% coverage: 7:244/275 of query aligns to 3:240/262 of 7chaI
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
42% identity, 87% coverage: 7:244/275 of query aligns to 3:237/259 of 7ch8I
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
42% identity, 87% coverage: 6:244/275 of query aligns to 3:241/264 of 6xgyA
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
42% identity, 87% coverage: 6:244/275 of query aligns to 3:241/265 of 7ch6C
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
41% identity, 87% coverage: 6:244/275 of query aligns to 3:241/263 of 7cgnB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 92% coverage: 8:261/275 of query aligns to 2:257/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 92% coverage: 8:261/275 of query aligns to 3:258/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 92% coverage: 8:261/275 of query aligns to 3:258/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 92% coverage: 8:261/275 of query aligns to 3:258/344 of 3tuiC
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 85% coverage: 8:242/275 of query aligns to 85:334/345 of Q9AT00
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 87% coverage: 8:245/275 of query aligns to 2:238/240 of 4ymuJ
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
36% identity, 73% coverage: 23:224/275 of query aligns to 18:217/222 of 8i6rB
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
34% identity, 76% coverage: 23:231/275 of query aligns to 42:250/260 of 7ahdC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 76% coverage: 23:231/275 of query aligns to 42:250/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 76% coverage: 23:231/275 of query aligns to 42:250/382 of 7aheC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 82% coverage: 7:231/275 of query aligns to 6:230/375 of 2d62A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 80% coverage: 8:227/275 of query aligns to 5:219/285 of 4yerA
>WP_011382778.1 NCBI__GCF_000009985.1:WP_011382778.1
MAGPGNSIEVSNLVAHYGSRQILHDVSLNVARGEIMVIMGGSGSGKTTLLSHLLGLKKPS
AGTVRILGHDIARLSPIALQRLRTRTGVAFQSGALFSSMTVGDNIALPLREHTELDETTI
GIMTRLKLEVVSLAGFEHLKPAELSGGMIKRAALARAIVMDPELLFCDEPSAGLDPVVAS
SIDDLILRLRDAMGMSIVVVTHDLDSTFKIADRICVLDKGHVLALDTVDAIRASRDPRIQ
NLLNRRTEEAEPDAESYLRRLTGGHAHSTDRTRSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory