SitesBLAST
Comparing WP_011382976.1 NCBI__GCF_000009985.1:WP_011382976.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
31% identity, 45% coverage: 8:377/819 of query aligns to 2:344/359 of Q8U1K9
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
29% identity, 46% coverage: 4:381/819 of query aligns to 1:354/379 of Q9AL95
- C26 (≠ A29) modified: Disulfide link with 286
- NSE 33:35 (≠ GAE 39:41) binding
- R42 (= R48) binding
- A79 (≠ V85) binding
- Y125 (≠ R133) binding
- C137 (≠ A145) modified: Disulfide link with 216
- C216 (≠ L239) modified: Disulfide link with 137
- D259 (≠ E282) binding
- C286 (≠ A309) modified: Disulfide link with 26
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
29% identity, 46% coverage: 8:381/819 of query aligns to 4:353/378 of 3kljA
- active site: P12 (≠ M16), R41 (= R48), P42 (≠ I49), N274 (≠ W298)
- binding flavin-adenine dinucleotide: L8 (≠ I12), G9 (= G13), G11 (= G15), P12 (≠ M16), A13 (= A17), N32 (≠ G39), S33 (≠ A40), E34 (= E41), R41 (= R48), P42 (≠ I49), F77 (≠ P84), A78 (≠ V85), S105 (≠ T112), G106 (= G113), L123 (≠ F132), Y124 (≠ R133), L150 (= L159), G257 (= G281), D258 (≠ E282), G268 (= G292), L269 (= L293), I270 (≠ V294), A273 (≠ I297), K301 (= K326)
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
31% identity, 45% coverage: 7:377/819 of query aligns to 1:339/346 of 1xhcA
- active site: P10 (≠ M16), K38 (≠ R48), P39 (≠ I49), F145 (≠ L158), E149 (= E162), M276 (≠ W298)
- binding flavin-adenine dinucleotide: V6 (≠ I12), G7 (= G13), G9 (= G15), P10 (≠ M16), G11 (≠ A17), D29 (≠ G39), K30 (≠ A40), K38 (≠ R48), P39 (≠ I49), E74 (≠ P84), A75 (≠ V85), A100 (≠ S111), T101 (= T112), G102 (= G113), L119 (≠ F132), R120 (= R133), F145 (≠ L158), I146 (≠ L159), E149 (= E162), G259 (= G281), D260 (≠ E282), G270 (= G292), T271 (≠ L293), A272 (≠ V294)
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
37% identity, 27% coverage: 88:310/819 of query aligns to 89:321/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
33% identity, 38% coverage: 9:320/819 of query aligns to 4:318/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G13), G10 (= G15), H11 (≠ M16), A12 (= A17), D34 (≠ A40), E35 (= E41), R42 (= R48), P43 (≠ I49), S46 (= S52), K47 (vs. gap), R78 (≠ P84), M79 (≠ V85), T106 (= T112), R127 (= R133), I153 (≠ L159), D275 (≠ E282), S292 (≠ L293), V293 (= V294)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
31% identity, 36% coverage: 45:339/819 of query aligns to 40:335/443 of 6rvhA
- active site: C44 (≠ I49), E53 (= E58), E58 (≠ D62), Y159 (≠ L158), E163 (= E162)
- binding coenzyme a: S40 (≠ N45), Y41 (= Y46), C44 (≠ I49), R63 (≠ N67), N303 (vs. gap), R307 (≠ K302)
- binding flavin-adenine dinucleotide: A43 (≠ R48), C44 (≠ I49), V81 (= V85), T113 (= T112), G114 (= G113), R134 (= R133), Y159 (≠ L158), G280 (= G281), D281 (≠ E282), P297 (vs. gap), L298 (vs. gap), G299 (vs. gap)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 20, 23, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
31% identity, 36% coverage: 45:339/819 of query aligns to 40:335/443 of 6rvbA
- active site: C44 (≠ I49), E53 (= E58), E58 (≠ D62), Y159 (≠ L158), E163 (= E162)
- binding coenzyme a: S40 (≠ N45), Y41 (= Y46), C44 (≠ I49), R63 (≠ N67), N303 (vs. gap), R307 (≠ K302)
- binding flavin-adenine dinucleotide: A43 (≠ R48), C44 (≠ I49), E80 (≠ P84), V81 (= V85), T113 (= T112), G114 (= G113), L133 (≠ F132), R134 (= R133), I160 (≠ L159), G280 (= G281), D281 (≠ E282), L298 (vs. gap), G299 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G156 (= G155), G158 (= G157), Y159 (≠ L158), I160 (≠ L159), E179 (≠ H178), A180 (≠ L179), A240 (= A243), T241 (≠ I244), G242 (= G245), P297 (vs. gap), I328 (≠ V332), F329 (= F333)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 20, 23, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
31% identity, 36% coverage: 45:339/819 of query aligns to 40:335/443 of 6ruzA
- active site: C44 (≠ I49), E53 (= E58), E58 (≠ D62), Y159 (≠ L158), E163 (= E162)
- binding coenzyme a: S40 (≠ N45), Y41 (= Y46), C44 (≠ I49), R63 (≠ N67), N303 (vs. gap), R307 (≠ K302)
- binding flavin-adenine dinucleotide: A43 (≠ R48), C44 (≠ I49), E80 (≠ P84), V81 (= V85), T113 (= T112), G114 (= G113), A115 (≠ S114), L133 (≠ F132), R134 (= R133), Y159 (≠ L158), G280 (= G281), D281 (≠ E282), P297 (vs. gap), L298 (vs. gap), G299 (vs. gap)
Sites not aligning to the query:
- active site: 39, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 424, 425
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
31% identity, 31% coverage: 64:318/819 of query aligns to 60:345/565 of 3nt6A
- active site: N325 (≠ W298)
- binding coenzyme a: A321 (≠ V294), N325 (≠ W298), R329 (≠ K302)
- binding flavin-adenine dinucleotide: E80 (≠ P84), V81 (= V85), S112 (= S111), P113 (≠ T112), G114 (= G113), L133 (≠ F132), R134 (= R133), F161 (≠ L158), G302 (= G281), D303 (≠ E282), P319 (vs. gap), L320 (= L293), A321 (≠ V294)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
35% identity, 31% coverage: 35:286/819 of query aligns to 31:283/409 of 3lxdA
- active site: R44 (= R48), P45 (≠ I49)
- binding flavin-adenine dinucleotide: R36 (≠ A40), E37 (= E41), R44 (= R48), P45 (≠ I49), S48 (= S52), K49 (≠ S53), E81 (≠ P84), V82 (= V85), T109 (= T112), I157 (≠ L159), G278 (= G281), D279 (≠ E282)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 34% coverage: 9:283/819 of query aligns to 4:275/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G15), V11 (≠ M16), G12 (≠ A17), D34 (≠ A40), E35 (= E41), R42 (= R48), P43 (≠ I49), K47 (vs. gap), E78 (≠ P84), V79 (= V85), T106 (= T112), G107 (= G113), G273 (= G281), D274 (≠ E282)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ L117), G149 (= G155), L152 (= L158), I153 (≠ L159), E156 (= E162), E172 (≠ H178), A173 (≠ L179), R180 (= R186), V236 (≠ I244), G237 (= G245), A238 (≠ I246)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 34% coverage: 9:283/819 of query aligns to 5:276/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G15), V12 (≠ M16), G13 (≠ A17), D35 (≠ A40), E36 (= E41), R43 (= R48), P44 (≠ I49), S47 (= S52), K48 (vs. gap), V80 (= V85), T107 (= T112), G108 (= G113), R128 (= R133), G274 (= G281), D275 (≠ E282)
Sites not aligning to the query:
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
28% identity, 45% coverage: 8:375/819 of query aligns to 2:376/424 of 8c0zE
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
30% identity, 37% coverage: 8:310/819 of query aligns to 2:313/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I12), G7 (= G13), V9 (≠ G15), G11 (≠ A17), E32 (≠ G39), K33 (≠ A40), C42 (≠ I49), V80 (= V85), S109 (= S111), P110 (≠ T112), G111 (= G113), I159 (≠ L159), G278 (= G281), D279 (≠ E282), S295 (≠ G292), L296 (= L293), A297 (≠ V294)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ E23), R18 (≠ E24), R21 (≠ A27), F70 (≠ N75), R305 (≠ K302)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 38% coverage: 1:314/819 of query aligns to 1:325/422 of P16640
- A15 (= A17) binding
- D37 (≠ G39) binding
- K50 (≠ S52) binding
- V83 (= V85) binding
- R134 (= R133) binding
- D284 (≠ E282) binding
- V302 (= V294) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 37% coverage: 8:314/819 of query aligns to 5:324/422 of 1q1wA
- active site: L13 (≠ M16), L44 (≠ N47), P45 (≠ R48), L305 (≠ W298)
- binding flavin-adenine dinucleotide: G10 (= G13), G12 (= G15), L13 (≠ M16), A14 (= A17), G35 (≠ F38), D36 (≠ G39), L44 (≠ N47), P45 (≠ R48), K49 (≠ S52), V82 (= V85), A108 (≠ S111), T109 (= T112), G110 (= G113), R133 (= R133), I159 (≠ L159), D283 (≠ E282), S300 (vs. gap), V301 (= V294)
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
30% identity, 37% coverage: 6:310/819 of query aligns to 1:302/381 of 2v3aA
- active site: L11 (≠ M16), K42 (≠ R48), P43 (≠ I49), M290 (≠ W298)
- binding flavin-adenine dinucleotide: I7 (= I12), G8 (= G13), T9 (≠ N14), G10 (= G15), A12 (= A17), T33 (≠ G39), A34 (= A40), D35 (≠ E41), K42 (≠ R48), P43 (≠ I49), R79 (≠ P84), V80 (= V85), A105 (≠ S111), W106 (≠ T112), G107 (= G113), I153 (≠ L159), F157 (≠ A163), D274 (≠ E282), L284 (≠ G292), Y285 (≠ L293), V286 (= V294)
Sites not aligning to the query:
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 37% coverage: 6:310/819 of query aligns to 4:305/384 of Q9HTK9
Sites not aligning to the query:
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 28% coverage: 62:292/819 of query aligns to 72:306/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
Query Sequence
>WP_011382976.1 NCBI__GCF_000009985.1:WP_011382976.1
MNALPRQKLVVIGNGMAGMRTVEELLAIAPARYDITVFGAEPHPNYNRIMLSSVLAGEKQ
VDDIVINPRAWYAENGITLHTGDPVVAIDRAAKTVTSANGVVVPYDKLLLSTGSKPLMPP
LPGLDLPGVVAFRDIADVEKMLDAAEAKQRAVVIGGGLLGLEAAWGLKRRGMPVALVHLM
PTLMERQLDVEAGGLLQKDLTERGLHFFTSGQTEEIMGAETGRAQGVKLTDGREIPADLV
VVAIGIRPNVDLAKAAGLDINRGIEVGDDMATSDPAIYSVGECVEHRGQIFGLVAPIWEQ
AKVCASRLAGRDDAHYETPPLSTRLKITGIDVFSAGQLAAQDEADEELVYRDSARGIYKK
LVIRADKVVGAVMYGDVADGSWYFQLIREKADVAAIRDRMIFGQAYADTTCKGHAGGVNV
AATSDDAQVCGCNGVSKGAIVKAITEKGLTSLDEVKLHTKASASCGQCASVVQAILTHVT
GEVVDAKAAGMCGCTDLSHDEVRREILHQGLKTQDAVRQALGWRHADGCAKCRPALNYYL
LCAWPSEYVDDYQSRFINERAHANIQKDGTYSVIPRMWGGLTNPTELRAIADVVDKFKIP
TVKVTGGQRLDLLGVRKEDLPGVWAVLGKAGLVSGHGYAKGLRTVKTCVGSEWCRFGTQD
STGLGVKLEKLMWGSWTPHKVKLAVSGCPRNCAEATIKDMGVVCVEAGYDISVGGNGGIE
LRGTDHLVRVTSEEEVLEYCGAFMQIYREEARYLERTAPWVERVGMDYITKRVVEDAEGR
RAAFARFVFSQNYAQIDPWAERASGEVDAHEFKTLAEVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory