Comparing WP_011383020.1 NCBI__GCF_000009985.1:WP_011383020.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
60% identity, 96% coverage: 3:282/291 of query aligns to 3:280/288 of 2ux8G
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
52% identity, 96% coverage: 5:282/291 of query aligns to 5:247/255 of 2ux8A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
50% identity, 98% coverage: 4:288/291 of query aligns to 4:289/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
52% identity, 92% coverage: 4:272/291 of query aligns to 2:266/282 of 5ve7A
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
48% identity, 90% coverage: 5:267/291 of query aligns to 8:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
42% identity, 98% coverage: 5:288/291 of query aligns to 2:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
42% identity, 98% coverage: 5:288/291 of query aligns to 2:289/290 of 6k8dA
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
42% identity, 93% coverage: 5:274/291 of query aligns to 2:264/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
42% identity, 93% coverage: 5:274/291 of query aligns to 2:264/264 of 3jukD
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
41% identity, 98% coverage: 5:288/291 of query aligns to 2:284/285 of 6ikzB
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
43% identity, 96% coverage: 8:286/291 of query aligns to 5:285/291 of 8b6dA
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
40% identity, 98% coverage: 5:288/291 of query aligns to 3:289/299 of 2pa4B
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
41% identity, 96% coverage: 8:286/291 of query aligns to 5:280/286 of 8b68A
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
29% identity, 81% coverage: 6:240/291 of query aligns to 2:206/293 of 5ifyA
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 81% coverage: 6:240/291 of query aligns to 4:208/295 of 6n0uA
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
31% identity, 73% coverage: 7:217/291 of query aligns to 2:184/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
31% identity, 73% coverage: 7:217/291 of query aligns to 2:184/360 of 7d72K
Sites not aligning to the query:
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
31% identity, 73% coverage: 7:217/291 of query aligns to 2:184/360 of 7d72E
Sites not aligning to the query:
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 79% coverage: 4:234/291 of query aligns to 2:202/292 of P26393
Sites not aligning to the query:
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
26% identity, 79% coverage: 4:234/291 of query aligns to 1:201/290 of 1h5tA
Sites not aligning to the query:
>WP_011383020.1 NCBI__GCF_000009985.1:WP_011383020.1
MTRRVRKAVFPVGGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAAAAGCEHFIFVTGR
GKNALEDHFDHNPELERILKDRGKFDLVEAVTSWMPKSGQISYTRQSEPLGLGHAVWCAR
DLVADEPFAVLLPDDLILSKTACLKQMAAVHTEVGGHVVAVSDVPREHTKRYGILDVEHD
NGRLARAKGLVEKPDPDVAPSTLSIIGRYILHPAVFDVLDKKEKGAGGEIQLTDAISQTI
GMVPFHGLRFEGNRFDCGDKVGWLEANLAFALARDDTAEAARDLITRFHKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory