SitesBLAST
Comparing WP_011383106.1 NCBI__GCF_000009985.1:WP_011383106.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
63% identity, 99% coverage: 1:312/316 of query aligns to 2:314/315 of 4jnqA
- active site: C137 (= C136), C140 (= C139), D141 (= D140)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L11), G13 (= G12), S14 (= S13), G15 (= G14), P16 (= P15), A17 (= A16), A36 (= A35), G37 (= G36), Q39 (= Q38), G42 (= G41), Q43 (= Q42), L44 (= L43), N52 (= N51), I85 (= I84), A113 (≠ C112), T114 (= T113), C140 (= C139), G283 (= G281), D284 (= D282), R291 (= R289), Q292 (= Q290), A293 (= A291)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
59% identity, 97% coverage: 5:309/316 of query aligns to 8:315/319 of 5vt3B
- active site: C138 (= C136), C141 (= C139), D142 (= D140)
- binding flavin-adenine dinucleotide: G15 (= G12), S16 (= S13), G17 (= G14), P18 (= P15), A19 (= A16), T38 (≠ A35), G39 (= G36), Q41 (= Q38), G44 (= G41), Q45 (= Q42), L46 (= L43), T49 (= T46), N54 (= N51), H86 (≠ T83), I87 (= I84), S114 (≠ C112), T115 (= T113), G116 (= G114), E162 (= E160), H247 (= H244), G287 (= G281), D288 (= D282), R295 (= R289), Q296 (= Q290), A297 (= A291), S300 (≠ A294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L120), G156 (= G154), G157 (= G155), N158 (= N156), T159 (≠ S157), H178 (= H176), R179 (= R177), R180 (= R178), R184 (= R182), I245 (= I242), G246 (= G243), R295 (= R289), Q296 (= Q290)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
58% identity, 97% coverage: 5:312/316 of query aligns to 9:319/319 of 5u63B
- active site: C139 (= C136), C142 (= C139), D143 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G12), S17 (= S13), G18 (= G14), P19 (= P15), A20 (= A16), T39 (≠ A35), G40 (= G36), Q42 (= Q38), G45 (= G41), Q46 (= Q42), L47 (= L43), T50 (= T46), N55 (= N51), H87 (≠ T83), I88 (= I84), A115 (≠ C112), T116 (= T113), G117 (= G114), H248 (= H244), G288 (= G281), D289 (= D282), R296 (= R289), Q297 (= Q290), A298 (= A291), S301 (≠ A294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R118), G157 (= G154), H179 (= H176), R180 (= R177), R181 (= R178), I246 (= I242), G247 (= G243), H248 (= H244), R296 (= R289)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
57% identity, 97% coverage: 5:309/316 of query aligns to 6:314/321 of P0A9P4
- 36:43 (vs. 35:42, 50% identical) binding
- C136 (= C136) modified: Disulfide link with 139, Redox-active
- C139 (= C139) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 282:291, 80% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
57% identity, 97% coverage: 5:309/316 of query aligns to 5:313/320 of 1f6mA
- active site: S135 (≠ C136), C138 (= C139), D139 (= D140)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L120), G153 (= G154), G154 (= G155), N155 (= N156), T156 (≠ S157), E159 (= E160), H175 (= H176), R176 (= R177), R177 (= R178), R181 (= R182), I243 (= I242), G244 (= G243), H245 (= H244), R293 (= R289), Q294 (= Q290)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), T35 (≠ A35), G36 (= G36), E38 (≠ Q38), G41 (= G41), Q42 (= Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), H83 (≠ T83), I84 (= I84), A111 (≠ C112), T112 (= T113), G113 (= G114), H245 (= H244), G285 (= G281), D286 (= D282), R293 (= R289), Q294 (= Q290), A295 (= A291), S298 (≠ A294)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
57% identity, 97% coverage: 5:309/316 of query aligns to 5:313/316 of 1tdfA
- active site: C135 (= C136), S138 (≠ C139), D139 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), T35 (≠ A35), G36 (= G36), E38 (≠ Q38), G41 (= G41), Q42 (= Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), H83 (≠ T83), I84 (= I84), A111 (≠ C112), T112 (= T113), S138 (≠ C139), G285 (= G281), D286 (= D282), R293 (= R289), Q294 (= Q290), A295 (= A291), S298 (≠ A294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L120), I151 (≠ M152), T156 (≠ S157), E159 (= E160), H175 (= H176), R176 (= R177), R181 (= R182), E183 (= E184), I243 (= I242), G244 (= G243), H290 (≠ K286), R293 (= R289)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
53% identity, 97% coverage: 5:310/316 of query aligns to 17:331/356 of 5w4cA
- binding calcium ion: E99 (≠ D82), E116 (≠ A96), E118 (≠ G98)
- binding flavin-adenine dinucleotide: I23 (≠ L11), G24 (= G12), S25 (= S13), P27 (= P15), G28 (≠ A16), Y46 (vs. gap), G48 (vs. gap), A51 (≠ V34), F54 (≠ L37), G58 (= G41), Q59 (= Q42), L60 (= L43), T63 (= T46), N68 (= N51), V101 (≠ I84), T134 (= T113), G135 (= G114), G302 (= G281), D303 (= D282), R310 (= R289), Q311 (= Q290), A312 (= A291), S315 (≠ A294)
Sites not aligning to the query:
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
51% identity, 99% coverage: 1:313/316 of query aligns to 46:368/375 of Q39243
- SGPA 58:61 (= SGPA 13:16) binding
- FE 79:80 (≠ VA 34:35) binding
- IAPGGQ 87:92 (≠ LQPGGQ 37:42) binding
- N101 (= N51) binding
- V134 (≠ I84) binding
- C189 (= C136) modified: Disulfide link with 192, Redox-active
- C192 (= C139) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D282) binding
- RQA 344:346 (= RQA 289:291) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
48% identity, 100% coverage: 2:316/316 of query aligns to 10:322/335 of P9WHH1
- SGPA 22:25 (= SGPA 13:16) binding
- Y32 (= Y23) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 35:42, 38% identical) binding
- N60 (= N51) binding
- V93 (≠ I84) binding
- C145 (= C136) modified: Disulfide link with 148, Redox-active
- C148 (= C139) modified: Disulfide link with 145, Redox-active
- S166 (= S157) binding
- H185 (= H176) binding
- R191 (= R182) binding
- I248 (= I242) binding
- Y268 (= Y262) binding
- D288 (= D282) binding
- R295 (= R289) binding
- RQAV 295:298 (= RQAV 289:292) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
48% identity, 100% coverage: 2:316/316 of query aligns to 1:313/313 of 2a87A
- active site: F39 (≠ P39), L43 (= L43), D48 (= D48), C136 (= C136), C139 (= C139), D140 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), F34 (≠ V34), E35 (≠ A35), G36 (= G36), G40 (= G40), G41 (= G41), A42 (≠ Q42), L43 (= L43), T46 (= T46), V49 (= V49), N51 (= N51), D83 (≠ T83), V84 (≠ I84), M113 (≠ T113), C139 (= C139), G278 (= G281), D279 (= D282), R286 (= R289), Q287 (= Q290), A288 (= A291), V289 (= V292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L120), G155 (= G155), D156 (≠ N156), S157 (= S157), H176 (= H176), R177 (= R177), R178 (= R178), R182 (= R182), I239 (= I242), Y259 (= Y262), R283 (≠ K286), R286 (= R289)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
51% identity, 96% coverage: 8:309/316 of query aligns to 6:303/306 of 5uthA
- active site: C133 (= C136), C136 (= C139), D137 (= D140)
- binding flavin-adenine dinucleotide: I9 (≠ L11), G10 (= G12), S11 (= S13), G12 (= G14), P13 (= P15), A14 (= A16), F32 (≠ V34), E33 (≠ A35), G34 (= G36), Q36 (= Q38), G39 (= G41), A40 (≠ Q42), L41 (= L43), N49 (= N51), D81 (≠ T83), V82 (≠ I84), M110 (≠ T113), G111 (= G114), C136 (= C139), G275 (= G281), D276 (= D282), R283 (= R289), Q284 (= Q290), A285 (= A291), A288 (= A294)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
50% identity, 97% coverage: 5:309/316 of query aligns to 2:319/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), Y31 (≠ V34), E32 (≠ A35), G33 (= G36), A36 (vs. gap), T38 (vs. gap), A39 (≠ Q38), G42 (= G41), Q43 (= Q42), L44 (= L43), T47 (= T46), I50 (≠ V49), N52 (= N51), T84 (= T83), I85 (= I84), T120 (= T113), G121 (= G114), C146 (= C139), G291 (= G281), D292 (= D282), R299 (= R289), Q300 (= Q290), A301 (= A291), S304 (≠ A294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G154), G164 (= G155), S166 (= S157), R186 (= R177), R187 (= R178), R191 (= R182), V252 (≠ I242)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
51% identity, 96% coverage: 8:309/316 of query aligns to 5:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (= Q38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ T83), V81 (≠ I84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (= A294)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R118), H115 (≠ W119), L116 (= L120), R173 (= R177), E200 (≠ V204), I201 (= I205), I235 (= I242)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
51% identity, 96% coverage: 8:309/316 of query aligns to 5:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (= Q38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ T83), V81 (≠ I84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (= A294)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L120), R173 (= R177), E200 (≠ V204), I201 (= I205)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
51% identity, 96% coverage: 8:309/316 of query aligns to 5:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (= Q38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ T83), V81 (≠ I84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (= A294)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R118), H115 (≠ W119), L116 (= L120), V148 (≠ M152), R173 (= R177), E200 (≠ V204), I201 (= I205)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
51% identity, 96% coverage: 8:309/316 of query aligns to 5:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L11), G9 (= G12), S10 (= S13), G11 (= G14), P12 (= P15), A13 (= A16), E32 (≠ A35), G33 (= G36), Q35 (= Q38), G38 (= G41), A39 (≠ Q42), L40 (= L43), T43 (= T46), N48 (= N51), D80 (≠ T83), V81 (≠ I84), M109 (≠ T113), G110 (= G114), T131 (≠ A135), C135 (= C139), G274 (= G281), D275 (= D282), R282 (= R289), Q283 (= Q290), A284 (= A291), A287 (= A294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G154), G151 (= G155), D152 (≠ N156), S153 (= S157), E156 (= E160), H172 (= H176), R173 (= R177), R174 (= R178), R178 (= R182), I235 (= I242)
1vdcA Structure of NADPH dependent thioredoxin reductase (see paper)
51% identity, 98% coverage: 1:309/316 of query aligns to 1:319/322 of 1vdcA
- active site: C144 (= C136), C147 (= C139), D148 (= D140)
- binding flavin-adenine dinucleotide: G12 (= G12), S13 (= S13), G14 (= G14), P15 (= P15), A16 (= A16), F34 (≠ V34), E35 (≠ A35), G36 (= G36), A39 (vs. gap), I42 (≠ L37), G46 (= G41), Q47 (= Q42), L48 (= L43), V54 (= V49), N56 (= N51), T88 (= T83), V89 (≠ I84), I117 (≠ T113), G118 (= G114), C147 (= C139), G291 (= G281), D292 (= D282), R299 (= R289), Q300 (= Q290), A301 (= A291), A304 (= A294)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
49% identity, 97% coverage: 8:312/316 of query aligns to 72:380/515 of Q70G58
- C203 (= C136) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C139) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A158) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H176) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R177) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
48% identity, 97% coverage: 4:311/316 of query aligns to 6:312/313 of 2q7vA
- active site: P41 (= P39), I45 (≠ L43), E50 (≠ D48), C141 (= C136), C144 (= C139), D145 (= D140)
- binding flavin-adenine dinucleotide: G16 (= G14), P17 (= P15), A18 (= A16), E37 (≠ A35), K38 (≠ G36), G43 (= G41), Q44 (= Q42), I45 (≠ L43), N53 (= N51), E85 (≠ T83), V86 (≠ I84), T118 (= T113), G119 (= G114), C144 (= C139), G282 (= G281), D283 (= D282), Q291 (= Q290), L292 (≠ A291), S295 (≠ A294)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 97% coverage: 5:309/316 of query aligns to 3:315/322 of Q92375
- S192 (≠ E184) modified: Phosphoserine
- T278 (= T272) modified: Phosphothreonine
- S279 (≠ N273) modified: Phosphoserine
Query Sequence
>WP_011383106.1 NCBI__GCF_000009985.1:WP_011383106.1
MAHHHSKVLILGSGPAGCTAAIYAARANLEPMLVAGLQPGGQLTITTDVENFPGFAEAVQ
GPWLMEQMQAQAEHVGTRFMDDTIVSVDLSKRPFTAVGDSGDTYAGDTLIICTGATARWL
GLESEKKFSGFGVSACATCDGFFFRGKEVAVMGGGNSAVEEAIYLAGIASKVTLIHRRDT
LRAEKIAQDRLFANPKVAVVWDSVIDEIVGDDNPPGVTGVRLKNVKTGALSVLPVDGVFI
AIGHTPNTELFKGALEMDSEGYLITKAGATSTNIPGVFAAGDVQDKIYRQAVTAAGTGCM
AALEAERFLTAHGHTG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory