Comparing WP_011383116.1 NCBI__GCF_000009985.1:WP_011383116.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
61% identity, 98% coverage: 4:295/297 of query aligns to 30:321/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
61% identity, 98% coverage: 4:295/297 of query aligns to 3:294/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
61% identity, 98% coverage: 4:295/297 of query aligns to 3:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
61% identity, 98% coverage: 4:295/297 of query aligns to 3:294/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
59% identity, 98% coverage: 4:295/297 of query aligns to 75:366/370 of Q8TB92
Sites not aligning to the query:
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
58% identity, 96% coverage: 7:291/297 of query aligns to 4:288/301 of P13703
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
57% identity, 92% coverage: 6:279/297 of query aligns to 3:276/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
38% identity, 97% coverage: 9:295/297 of query aligns to 10:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 78% coverage: 6:238/297 of query aligns to 21:247/399 of 6ktqA
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
32% identity, 40% coverage: 162:280/297 of query aligns to 162:273/453 of 2nx9B
Sites not aligning to the query:
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
24% identity, 96% coverage: 1:285/297 of query aligns to 1:280/517 of Q9JZG1
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
24% identity, 95% coverage: 5:285/297 of query aligns to 2:277/308 of 3rmjB
P11154 Pyruvate carboxylase 1; Pyruvic carboxylase 1; PCB 1; EC 6.4.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 41% coverage: 162:282/297 of query aligns to 719:832/1178 of P11154
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
22% identity, 67% coverage: 88:285/297 of query aligns to 175:370/506 of Q9FG67
Sites not aligning to the query:
Q70AC7 Methylmalonyl-CoA carboxyltransferase 5S subunit; Transcarboxylase 5S subunit; EC 2.1.3.1 from Propionibacterium freudenreichii subsp. shermanii (see paper)
29% identity, 38% coverage: 162:273/297 of query aligns to 169:275/505 of Q70AC7
Sites not aligning to the query:
1rr2A Propionibacterium shermanii transcarboxylase 5s subunit bound to 2- ketobutyric acid (see paper)
29% identity, 38% coverage: 162:273/297 of query aligns to 167:273/472 of 1rr2A
Sites not aligning to the query:
1rqeA Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate (see paper)
29% identity, 38% coverage: 162:273/297 of query aligns to 167:273/472 of 1rqeA
Sites not aligning to the query:
1rqbA Propionibacterium shermanii transcarboxylase 5s subunit (see paper)
29% identity, 38% coverage: 162:273/297 of query aligns to 167:273/472 of 1rqbA
Sites not aligning to the query:
1rqhA Propionibacterium shermanii transcarboxylase 5s subunit bound to pyruvic acid (see paper)
29% identity, 38% coverage: 162:273/297 of query aligns to 166:272/471 of 1rqhA
Sites not aligning to the query:
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
22% identity, 67% coverage: 88:285/297 of query aligns to 108:303/409 of 6e1jA
Sites not aligning to the query:
>WP_011383116.1 NCBI__GCF_000009985.1:WP_011383116.1
MRHPSRVKIVEVGPRDGLQNEARPVAVEIRVGLINRLTGTGLTAIESGSFVSPKWVPQMA
ATAEVMAAITRRPGVAYPVLTPNLQGLEAALAAKVEEVAVFAAASETFSQKNINCSIAES
LERFAPLAARAKAEGLRVRGYVSCVLGCPYEGAVEPSAVAGVAEKLVAMGCYEISLGDTV
GVGTPAKAQAMIDAVTARLPVEMLAAHFHDTYGQALANLLAVMERGVAVMDSSVAGLGGC
PYAKGAAGNVASEDLVYMLNGMGIHTGIDLDRLIEAGTFICEALGRATGSKVARARA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory