SitesBLAST
Comparing WP_011383159.1 NCBI__GCF_000009985.1:WP_011383159.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 4:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K117), S176 (= S206), V177 (= V207), T195 (= T225), M199 (= M229), R201 (= R231), M235 (= M265), R254 (= R284), E257 (= E287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G40), T15 (= T42), G16 (= G43), S17 (= S44), F18 (= F45), S39 (= S66), R40 (= R67), D41 (= D68), K44 (= K71), D63 (= D93), V64 (= V94), A83 (= A113), A84 (= A114), A85 (= A115), K87 (= K117), L125 (= L155), S126 (= S156), Y137 (= Y167), K141 (= K171), Y167 (= Y197), G168 (= G198), V170 (= V200)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 4:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G40), T15 (= T42), G16 (= G43), S17 (= S44), F18 (= F45), R40 (= R67), D41 (= D68), K44 (= K71), D63 (= D93), V64 (= V94), A83 (= A113), A84 (= A114), A85 (= A115), K87 (= K117), L125 (= L155), S126 (= S156), K141 (= K171), Y167 (= Y197), G168 (= G198), V170 (= V200), R174 (= R204)
- binding uridine-5'-diphosphate-glucose: K87 (= K117), T127 (= T157), K129 (= K159), Y137 (= Y167), N169 (= N199), S176 (= S206), V177 (= V207), P193 (= P223), T195 (= T225), M199 (= M229), R201 (= R231), M235 (= M265), R254 (= R284), E257 (= E287)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 4:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G40), T15 (= T42), G16 (= G43), S17 (= S44), F18 (= F45), R40 (= R67), D41 (= D68), K44 (= K71), D63 (= D93), V64 (= V94), A84 (= A114), A85 (= A115), K87 (= K117), S126 (= S156), Y137 (= Y167), K141 (= K171), Y167 (= Y197), G168 (= G198), V170 (= V200), S173 (= S203), R174 (= R204)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K117), D128 (= D158), K129 (= K159), N169 (= N199), G175 (= G205), S176 (= S206), V177 (= V207), P193 (= P223), I194 (= I224), M199 (= M229), R201 (= R231), M235 (= M265), R254 (= R284), E257 (= E287)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 4:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G40), T15 (= T42), G16 (= G43), S17 (= S44), F18 (= F45), S39 (= S66), R40 (= R67), D41 (= D68), K44 (= K71), D63 (= D93), V64 (= V94), A83 (= A113), A84 (= A114), A85 (= A115), K87 (= K117), T102 (= T132), L125 (= L155), S126 (= S156), T127 (= T157), Y137 (= Y167), K141 (= K171), Y167 (= Y197), G168 (= G198), V170 (= V200), S173 (= S203), R174 (= R204)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K117), T127 (= T157), D128 (= D158), K129 (= K159), Y137 (= Y167), N169 (= N199), S176 (= S206), V177 (= V207), P193 (= P223), T195 (= T225), M199 (= M229), R201 (= R231), M235 (= M265), R254 (= R284), E257 (= E287)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 2:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G40), T13 (= T42), G14 (= G43), S15 (= S44), F16 (= F45), S37 (= S66), R38 (= R67), D39 (= D68), K42 (= K71), D61 (= D93), V62 (= V94), A81 (= A113), A82 (= A114), A83 (= A115), K85 (= K117), T100 (= T132), L123 (= L155), S124 (= S156), K139 (= K171), Y165 (= Y197), G166 (= G198), V168 (= V200), S171 (= S203), R172 (= R204)
- binding uridine-5'-diphosphate: K127 (= K159), N167 (= N199), V175 (= V207), P191 (= P223), I192 (= I224), T193 (= T225), M197 (= M229), R199 (= R231), M233 (= M265), R252 (= R284)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
59% identity, 90% coverage: 31:355/360 of query aligns to 8:333/333 of O25511
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
41% identity, 77% coverage: 34:311/360 of query aligns to 6:289/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G40), T14 (= T42), G15 (= G43), T16 (≠ S44), I17 (≠ F45), S37 (= S66), R38 (= R67), S39 (≠ D68), D63 (= D93), I64 (≠ V94), V83 (≠ A113), A84 (= A114), K87 (= K117), T125 (≠ L155), S127 (≠ T157), Y137 (= Y167), K141 (= K171), F167 (≠ Y197), V170 (= V200), S173 (= S203), R174 (= R204)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K117), H88 (≠ Q118), S127 (≠ T157), N128 (≠ D158), Y137 (= Y167), N169 (= N199), S176 (= S206), V177 (= V207), L180 (≠ F210), T192 (≠ P223), T194 (= T225), M198 (= M229), R200 (= R231), L234 (≠ M265), E265 (= E287)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
40% identity, 87% coverage: 29:341/360 of query aligns to 9:320/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G40), T22 (= T42), G23 (= G43), S24 (= S44), F25 (= F45), S45 (= S66), R46 (= R67), D47 (= D68), K50 (= K71), D69 (= D93), V70 (= V94), A89 (= A113), A90 (= A114), A91 (= A115), K93 (= K117), L131 (= L155), T133 (= T157), K147 (= K171), Y173 (= Y197)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q118), V95 (= V119), K135 (= K159), N175 (= N199), S182 (= S206), V183 (= V207), L186 (≠ F210), T198 (≠ P223), T200 (= T225), M204 (= M229), V240 (≠ M265), R263 (= R284), E266 (= E287), Y278 (= Y298), S313 (≠ D334), Y314 (≠ F335), E315 (≠ R336), Y316 (= Y337), N320 (= N341)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
40% identity, 87% coverage: 29:341/360 of query aligns to 9:320/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K117), Q94 (= Q118), N175 (= N199), S179 (= S203), R180 (= R204), S182 (= S206), V183 (= V207), L186 (≠ F210), T198 (≠ P223), I199 (= I224), T200 (= T225), M204 (= M229), R206 (= R231), V240 (≠ M265), R263 (= R284), E266 (= E287)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
40% identity, 87% coverage: 29:341/360 of query aligns to 1:292/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G40), T14 (= T42), G15 (= G43), F17 (= F45), S37 (= S66), R38 (= R67), D39 (= D68), K42 (= K71), D61 (= D93), V62 (= V94), R63 (= R95), A81 (= A113), A82 (= A114), A83 (= A115), K85 (= K117), S124 (= S156), T125 (= T157), K139 (= K171), Y165 (= Y197), G166 (= G198)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
44% identity, 73% coverage: 34:297/360 of query aligns to 5:268/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G40), T13 (= T42), G14 (= G43), S15 (= S44), F16 (= F45), S36 (= S66), R37 (= R67), D38 (= D68), K41 (= K71), D60 (= D93), V61 (= V94), A80 (= A113), A81 (= A114), A82 (= A115), K84 (= K117), T99 (= T132), L122 (= L155), K138 (= K171), Y164 (= Y197)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
40% identity, 67% coverage: 31:272/360 of query aligns to 1:213/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G40), T12 (= T42), G13 (= G43), S14 (= S44), F15 (= F45), S35 (= S66), R36 (= R67), D37 (= D68), K40 (= K71), D59 (= D93), V60 (= V94), A80 (= A114), A81 (= A115), K83 (= K117), L121 (= L155), T123 (= T157), K137 (= K171), Y163 (= Y197), G164 (= G198)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
30% identity, 79% coverage: 31:315/360 of query aligns to 3:267/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G40), S14 (≠ T42), G15 (= G43), S16 (= S44), L17 (≠ F45), R36 (= R67), D37 (= D68), D59 (= D93), I60 (≠ V94), A81 (= A113), A82 (= A114), A83 (= A115), K85 (= K117), V128 (≠ L155), Y140 (= Y167), K144 (= K171), Y168 (= Y197), G169 (= G198), V171 (= V200)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
29% identity, 76% coverage: 31:304/360 of query aligns to 22:297/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G40), G34 (= G43), T35 (≠ S44), I36 (≠ F45), D56 (≠ S66), H57 (≠ R67), S82 (≠ G92), I83 (≠ V94), A104 (= A113), A105 (= A114), A106 (= A115), K108 (= K117), N123 (≠ T132), I146 (≠ L155), K162 (= K171), F184 (≠ Y197), G185 (= G198), N186 (= N199), V187 (= V200), S190 (= S203), S191 (≠ R204)
- binding uridine-5'-diphosphate: K150 (= K159), N186 (= N199), S193 (= S206), V194 (= V207), T209 (≠ P223), L210 (≠ I224), T211 (= T225), I215 (≠ M229), R217 (= R231), E279 (= E287)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
29% identity, 76% coverage: 31:304/360 of query aligns to 22:297/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G40), G34 (= G43), T35 (≠ S44), I36 (≠ F45), D56 (≠ S66), H57 (≠ R67), S82 (≠ G92), I83 (≠ V94), A104 (= A113), A105 (= A114), A106 (= A115), K108 (= K117), N123 (≠ T132), I146 (≠ L155), K162 (= K171), F184 (≠ Y197), G185 (= G198), N186 (= N199), V187 (= V200), S190 (= S203), S191 (≠ R204)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K117), H109 (≠ Q118), T148 (= T157), G185 (= G198), N186 (= N199), S193 (= S206), V194 (= V207), T209 (≠ P223), L210 (≠ I224), T211 (= T225), I215 (≠ M229), R217 (= R231), R276 (= R284), E279 (= E287)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
25% identity, 69% coverage: 36:285/360 of query aligns to 3:296/322 of 1r66A
- active site: T127 (= T157), D128 (= D158), E129 (≠ K159), Y151 (= Y167), K155 (= K171)
- binding nicotinamide-adenine-dinucleotide: G10 (= G43), F11 (≠ S44), I12 (≠ F45), D37 (= D68), S38 (≠ E69), L39 (= L70), T40 (≠ K71), G43 (≠ E74), D63 (= D93), I64 (≠ V94), F83 (≠ A113), A84 (= A114), A85 (= A115), S87 (≠ K117), T102 (= T132), V125 (≠ L155), S126 (= S156), Y151 (= Y167), K155 (= K171), N181 (≠ V200)
- binding thymidine-5'-diphosphate: H88 (≠ Q118), E129 (≠ K159), N180 (= N199), K190 (≠ S206), L191 (≠ V207), P206 (≠ L222), Y208 (≠ I224), R215 (= R231), N250 (vs. gap), R274 (≠ M263), H277 (≠ T266)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
25% identity, 69% coverage: 36:285/360 of query aligns to 3:296/322 of 1r6dA
- active site: T127 (= T157), N128 (≠ D158), Q129 (≠ K159), Y151 (= Y167), K155 (= K171)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K117), H88 (≠ Q118), T127 (= T157), N128 (≠ D158), Q129 (≠ K159), Y151 (= Y167), N180 (= N199), K190 (≠ S206), L191 (≠ V207), P206 (≠ L222), Y208 (≠ I224), R215 (= R231), N250 (vs. gap), R274 (≠ M263), H277 (≠ T266), Y281 (≠ E270)
- binding nicotinamide-adenine-dinucleotide: G10 (= G43), F11 (≠ S44), I12 (≠ F45), D37 (= D68), S38 (≠ E69), L39 (= L70), T40 (≠ K71), A42 (≠ F73), G43 (≠ E74), D63 (= D93), I64 (≠ V94), F83 (≠ A113), A84 (= A114), A85 (= A115), S87 (≠ K117), T102 (= T132), V125 (≠ L155), S126 (= S156), Y151 (= Y167), K155 (= K171), N181 (≠ V200)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
25% identity, 62% coverage: 37:260/360 of query aligns to 34:256/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G43), S41 (= S44), I42 (≠ F45), D62 (≠ S66), I63 (≠ R67), D92 (vs. gap), I93 (vs. gap), L114 (≠ A113), S115 (≠ A114), A116 (= A115), K118 (= K117), V158 (≠ L155), D161 (= D158), K174 (= K171), V198 (= V200), S201 (= S203)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
25% identity, 48% coverage: 33:203/360 of query aligns to 1:181/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G40), G11 (= G43), Y12 (≠ S44), I13 (≠ F45), D32 (= D68), N33 (≠ E69), S35 (≠ K71), G37 (≠ F73), D57 (= D93), L58 (≠ V94), F79 (≠ A113), A80 (= A114), I83 (≠ K117), N98 (≠ T132), Y147 (= Y167), K151 (= K171), Y175 (= Y197), N177 (= N199), V178 (= V200)
6jkhA The NAD+-bound form of human nsdhl (see paper)
28% identity, 42% coverage: 32:183/360 of query aligns to 1:139/212 of 6jkhA
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), F13 (≠ S44), L14 (≠ F45), D33 (≠ E74), I34 (≠ M75), G48 (= G92), L50 (≠ V94), A70 (= A114), S71 (≠ A115), Y123 (= Y167), K127 (= K171)
Query Sequence
>WP_011383159.1 NCBI__GCF_000009985.1:WP_011383159.1
MGACHDPPKRHSRRRSDALTASQYYDIDLDLEGKSILVTGGTGSFGKKFVKTVLERYNPH
RLIIFSRDELKQFEMAQTFDPAQHRCLRYFLGDVRDAERLRMAMREVDVVVHAAALKQVP
AAEYNPFEFVRTNILGAENVVQAALANKVGHVIALSTDKAMSPINLYGATKLASDKIFVA
ANNLSGSVGTKFAVVRYGNVVGSRGSVVPFFHKLIQSGAAELPITDARMTRFWITLEQGV
DFVLSCLDKMQGGETYIPKIPSMRMTDLAEAMAPGKPHKIIGIRPGEKIHEVMITEDYAR
NTVELPDRYIIQPVFAFWTTEHLIDAGAKVVPDDFRYGSDNNTDWMDGPRLHAMLSGLEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory