SitesBLAST
Comparing WP_011383235.1 AMB_RS04050 thiamine pyrophosphate-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ahkA Crystal structure of acetohydroxy acid synthase pf5 from pseudomonas protegens
33% identity, 92% coverage: 1:566/613 of query aligns to 1:543/555 of 5ahkA
- active site: L22 (≠ V22), G24 (= G24), G25 (≠ A25), M26 (≠ A26), I27 (≠ N27), E48 (= E48), T73 (= T71), K110 (≠ D108), R111 (≠ P109), F118 (= F116), Q119 (= Q117), M168 (≠ L166), A253 (≠ T263), Q280 (≠ I290), V384 (≠ C405), G410 (≠ S431), M412 (= M433), D436 (= D458), N463 (= N485), S465 (≠ I487), L466 (≠ Y488), M468 (≠ I490), V469 (≠ T491), F472 (≠ Y494), D535 (≠ E558)
- binding flavin-adenine dinucleotide: R158 (= R156), G208 (= G217), G209 (= G218), G210 (= G219), S234 (≠ T243), L235 (≠ W244), M250 (≠ R260), L251 (≠ I261), Y254 (= Y264), G273 (= G283), S274 (= S284), R275 (= R285), D277 (≠ S287), R279 (= R289), Q280 (≠ I290), D298 (≠ H317), L299 (= L318), Q303 (≠ P322), E317 (≠ F334), L318 (= L335), M389 (≠ V410), G407 (≠ N428)
- binding magnesium ion: D436 (= D458), N463 (= N485), S465 (≠ I487)
- binding thiamine diphosphate: I23 (≠ Y23), E48 (= E48), P76 (= P74), V384 (≠ C405), G385 (= G406), N386 (≠ G407), N387 (= N408), G410 (≠ S431), M412 (= M433), D436 (= D458), G437 (= G459), G438 (= G460), N463 (= N485), S465 (≠ I487), L466 (≠ Y488), G467 (= G489), M468 (≠ I490), V469 (≠ T491)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
30% identity, 91% coverage: 2:560/613 of query aligns to 95:643/667 of P09342
- C161 (≠ T68) modified: Disulfide link with 307
- P194 (≠ N101) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V220) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
30% identity, 91% coverage: 2:560/613 of query aligns to 92:640/664 of P09114
- P191 (≠ N101) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ Y494) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
30% identity, 91% coverage: 11:568/613 of query aligns to 20:569/599 of 1n0hA
- active site: Y31 (≠ V22), G33 (= G24), G34 (≠ A25), A35 (= A26), I36 (≠ N27), E57 (= E48), T80 (= T71), F119 (= F116), Q120 (= Q117), E121 (= E118), K169 (≠ L166), R230 (≠ D227), M266 (≠ T263), V293 (≠ I290), V409 (vs. gap), L434 (≠ N430), G435 (≠ S431), M437 (= M433), D462 (= D458), N489 (= N485), E491 (≠ I487), Q492 (≠ Y488), M494 (≠ I490), V495 (≠ T491), W498 (≠ Y494), L520 (≠ I519), G525 (= G524), L526 (≠ V525), K559 (≠ E558)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (vs. gap), G410 (vs. gap), Q411 (vs. gap), H412 (vs. gap), G435 (≠ S431), M437 (= M433), G461 (= G457), D462 (= D458), A463 (≠ G459), S464 (≠ G460), M467 (= M463), N489 (= N485), E491 (≠ I487), Q492 (≠ Y488), G493 (= G489), V495 (≠ T491)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ A25), A35 (= A26), V109 (≠ I100), P110 (= P107), F119 (= F116), K169 (≠ L166), M266 (≠ T263), D291 (≠ G288), R292 (= R289), V495 (≠ T491), W498 (≠ Y494)
- binding flavin-adenine dinucleotide: R159 (= R156), G219 (= G217), A220 (≠ G218), G221 (= G219), N224 (≠ R221), T246 (= T243), L247 (≠ W244), Q248 (≠ N245), L264 (≠ I261), G265 (= G262), M266 (≠ T263), H267 (≠ Y264), G286 (= G283), A287 (≠ S284), R288 (= R285), D290 (≠ S287), R292 (= R289), V293 (≠ I290), E319 (≠ Q319), V320 (≠ Q320), N324 (≠ D324), G337 (≠ C329), D338 (= D330), A339 (= A331), M414 (vs. gap), G432 (≠ N428), G433 (= G429)
- binding magnesium ion: D462 (= D458), N489 (= N485), E491 (≠ I487)
- binding thiamine diphosphate: Y31 (≠ V22), E57 (= E48), P83 (= P74)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
30% identity, 91% coverage: 11:568/613 of query aligns to 18:566/596 of 1t9dA
- active site: Y29 (≠ V22), G31 (= G24), G32 (≠ A25), A33 (= A26), I34 (≠ N27), E55 (= E48), T78 (= T71), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (≠ L166), R227 (≠ D227), M263 (≠ T263), V290 (≠ I290), V406 (vs. gap), L431 (≠ N430), G432 (≠ S431), M434 (= M433), D459 (= D458), N486 (= N485), E488 (≠ I487), Q489 (≠ Y488), M491 (≠ I490), V492 (≠ T491), W495 (≠ Y494), L517 (≠ I519), G522 (= G524), L523 (≠ V525), K556 (≠ E558)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ A25), A33 (= A26), V107 (≠ I100), P108 (= P107), F117 (= F116), K167 (≠ L166), M263 (≠ T263), D288 (≠ G288), R289 (= R289), W495 (≠ Y494)
- binding flavin-adenine dinucleotide: R157 (= R156), G216 (= G217), A217 (≠ G218), G218 (= G219), N221 (≠ R221), T243 (= T243), L244 (≠ W244), Q245 (≠ N245), M260 (≠ R260), L261 (≠ I261), H264 (≠ Y264), G283 (= G283), A284 (≠ S284), R285 (= R285), D287 (≠ S287), R289 (= R289), V290 (≠ I290), E316 (≠ Q319), V317 (≠ Q320), N321 (≠ D324), G334 (≠ C329), D335 (= D330), A336 (= A331), Q410 (vs. gap), M411 (vs. gap), G429 (≠ N428), G430 (= G429)
- binding magnesium ion: D459 (= D458), N486 (= N485), E488 (≠ I487)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E48), P81 (= P74), Q118 (= Q117), G432 (≠ S431), M434 (= M433), M464 (= M463)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
30% identity, 91% coverage: 11:568/613 of query aligns to 19:567/597 of 1t9aA
- active site: Y30 (≠ V22), G32 (= G24), G33 (≠ A25), A34 (= A26), I35 (≠ N27), E56 (= E48), T79 (= T71), F118 (= F116), Q119 (= Q117), E120 (= E118), K168 (≠ L166), R228 (≠ D227), M264 (≠ T263), V291 (≠ I290), V407 (vs. gap), L432 (≠ N430), G433 (≠ S431), M435 (= M433), D460 (= D458), N487 (= N485), E489 (≠ I487), Q490 (≠ Y488), M492 (≠ I490), V493 (≠ T491), W496 (≠ Y494), L518 (≠ I519), G523 (= G524), L524 (≠ V525), K557 (≠ E558)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ A25), V108 (≠ I100), P109 (= P107), F118 (= F116), K168 (≠ L166), M264 (≠ T263), D289 (≠ G288), R290 (= R289), M492 (≠ I490), V493 (≠ T491), W496 (≠ Y494)
- binding flavin-adenine dinucleotide: R158 (= R156), G217 (= G217), A218 (≠ G218), G219 (= G219), N222 (≠ R221), T244 (= T243), L245 (≠ W244), Q246 (≠ N245), L262 (≠ I261), M264 (≠ T263), H265 (≠ Y264), G284 (= G283), A285 (≠ S284), R286 (= R285), D288 (≠ S287), R290 (= R289), V291 (≠ I290), E317 (≠ Q319), V318 (≠ Q320), N322 (≠ D324), G335 (≠ C329), D336 (= D330), A337 (= A331), Q411 (vs. gap), M412 (vs. gap), G430 (≠ N428), G431 (= G429)
- binding magnesium ion: D460 (= D458), N487 (= N485), E489 (≠ I487)
- binding propyl trihydrogen diphosphate: V407 (vs. gap), G408 (vs. gap), Q409 (vs. gap), H410 (vs. gap), M435 (= M433), G459 (= G457), D460 (= D458), A461 (≠ G459), S462 (≠ G460), N487 (= N485), E489 (≠ I487), Q490 (≠ Y488), G491 (= G489), M492 (≠ I490)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (≠ S431), M435 (= M433), M465 (= M463)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 91% coverage: 11:568/613 of query aligns to 102:657/687 of P07342
- R241 (= R156) binding
- 355:376 (vs. 264:285, 50% identical) binding
- 407:426 (vs. 319:330, 20% identical) binding
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
29% identity, 91% coverage: 11:568/613 of query aligns to 22:577/607 of 6u9dB
- active site: Y33 (≠ V22), G35 (= G24), G36 (≠ A25), A37 (= A26), I38 (≠ N27), E59 (= E48), T82 (= T71), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (≠ L166), M274 (≠ T263), V301 (≠ I290), V417 (vs. gap), G443 (≠ S431), M445 (= M433), D470 (= D458), N497 (= N485), E499 (≠ I487), Q500 (≠ Y488), M502 (≠ I490), V503 (≠ T491), W506 (≠ Y494)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ A25), V111 (≠ I100), P112 (= P107), F121 (= F116), K171 (≠ L166), D299 (≠ G288), R300 (= R289), M502 (≠ I490), W506 (≠ Y494)
- binding flavin-adenine dinucleotide: R161 (= R156), A228 (≠ G218), G229 (= G219), N232 (≠ R221), T254 (= T243), L255 (≠ W244), Q256 (≠ N245), L272 (≠ I261), M274 (≠ T263), G294 (= G283), R296 (= R285), D298 (≠ S287), R300 (= R289), V301 (≠ I290), E327 (≠ Q319), V328 (≠ Q320), N332 (≠ D324), D346 (= D330), A347 (= A331), M422 (vs. gap), G440 (≠ N428), G441 (= G429)
- binding magnesium ion: D470 (= D458), N497 (= N485)
- binding thiamine diphosphate: E59 (= E48), P85 (= P74), V417 (vs. gap), G418 (vs. gap), Q419 (vs. gap), H420 (vs. gap), G443 (≠ S431), M445 (= M433), A471 (≠ G459), S472 (≠ G460), N497 (= N485), E499 (≠ I487), Q500 (≠ Y488), G501 (= G489), M502 (≠ I490), V503 (≠ T491)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
29% identity, 91% coverage: 11:568/613 of query aligns to 18:566/596 of 1t9cA
- active site: Y29 (≠ V22), G31 (= G24), G32 (≠ A25), A33 (= A26), I34 (≠ N27), E55 (= E48), T78 (= T71), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (≠ L166), R227 (≠ D227), M263 (≠ T263), V290 (≠ I290), V406 (vs. gap), L431 (≠ N430), G432 (≠ S431), M434 (= M433), D459 (= D458), N486 (= N485), E488 (≠ I487), Q489 (≠ Y488), M491 (≠ I490), V492 (≠ T491), W495 (≠ Y494), L517 (≠ I519), G522 (= G524), L523 (≠ V525), K556 (≠ E558)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ A25), V107 (≠ I100), P108 (= P107), F117 (= F116), K167 (≠ L166), D288 (≠ G288), R289 (= R289), W495 (≠ Y494)
- binding flavin-adenine dinucleotide: R157 (= R156), G216 (= G217), A217 (≠ G218), G218 (= G219), N221 (≠ R221), T243 (= T243), L244 (≠ W244), Q245 (≠ N245), L261 (≠ I261), M263 (≠ T263), H264 (≠ Y264), G283 (= G283), A284 (≠ S284), R285 (= R285), D287 (≠ S287), R289 (= R289), V290 (≠ I290), E316 (≠ Q319), V317 (≠ Q320), N321 (≠ D324), G334 (≠ C329), D335 (= D330), A336 (= A331), M411 (vs. gap), G429 (≠ N428), G430 (= G429)
- binding magnesium ion: D459 (= D458), N486 (= N485), E488 (≠ I487)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
29% identity, 91% coverage: 11:568/613 of query aligns to 18:561/591 of 5wkcA
- active site: Y29 (≠ V22), G31 (= G24), G32 (≠ A25), A33 (= A26), I34 (≠ N27), E55 (= E48), T78 (= T71), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (≠ L166), R222 (≠ D227), M258 (≠ T263), V285 (≠ I290), V401 (vs. gap), L426 (≠ N430), G427 (≠ S431), M429 (= M433), D454 (= D458), N481 (= N485), E483 (≠ I487), Q484 (≠ Y488), M486 (≠ I490), V487 (≠ T491), W490 (≠ Y494), L512 (≠ I519), G517 (= G524), L518 (≠ V525), K551 (≠ E558)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (vs. gap), G402 (vs. gap), Q403 (vs. gap), H404 (vs. gap), G427 (≠ S431), M429 (= M433), G453 (= G457), D454 (= D458), A455 (≠ G459), S456 (≠ G460), M459 (= M463), N481 (= N485), E483 (≠ I487), Q484 (≠ Y488), G485 (= G489), M486 (≠ I490), V487 (≠ T491)
- binding ethaneperoxoic acid: G32 (≠ A25), Q118 (= Q117)
- binding flavin-adenine dinucleotide: R157 (= R156), G211 (= G217), A212 (≠ G218), G213 (= G219), N216 (≠ R221), T238 (= T243), L239 (≠ W244), Q240 (≠ N245), L256 (≠ I261), M258 (≠ T263), G278 (= G283), A279 (≠ S284), R280 (= R285), R284 (= R289), V285 (≠ I290), E311 (≠ Q319), V312 (≠ Q320), N316 (≠ D324), D330 (= D330), A331 (= A331), M406 (vs. gap), G424 (≠ N428)
- binding magnesium ion: D454 (= D458), N481 (= N485), E483 (≠ I487)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ A25), A33 (= A26), V107 (≠ I100), F117 (= F116), K167 (≠ L166), M258 (≠ T263), R284 (= R289), M486 (≠ I490), W490 (≠ Y494)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (≠ Y23), E55 (= E48)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
29% identity, 91% coverage: 11:568/613 of query aligns to 18:565/595 of 1t9bB
- active site: Y29 (≠ V22), G31 (= G24), G32 (≠ A25), A33 (= A26), I34 (≠ N27), E55 (= E48), T78 (= T71), F117 (= F116), Q118 (= Q117), E119 (= E118), K167 (≠ L166), R226 (≠ D227), M262 (≠ T263), V289 (≠ I290), V405 (vs. gap), L430 (≠ N430), G431 (≠ S431), M433 (= M433), D458 (= D458), N485 (= N485), E487 (≠ I487), Q488 (≠ Y488), M490 (≠ I490), V491 (≠ T491), W494 (≠ Y494), L516 (≠ I519), G521 (= G524), L522 (≠ V525), K555 (≠ E558)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ I100), P108 (= P107), D287 (≠ G288), R288 (= R289), M490 (≠ I490), W494 (≠ Y494)
- binding flavin-adenine dinucleotide: R157 (= R156), G215 (= G217), A216 (≠ G218), G217 (= G219), N220 (≠ R221), T242 (= T243), L243 (≠ W244), Q244 (≠ N245), M259 (≠ R260), L260 (≠ I261), M262 (≠ T263), H263 (≠ Y264), G282 (= G283), A283 (≠ S284), R284 (= R285), D286 (≠ S287), R288 (= R289), V289 (≠ I290), E315 (≠ Q319), V316 (≠ Q320), N320 (≠ D324), G333 (≠ C329), D334 (= D330), A335 (= A331), Q409 (vs. gap), M410 (vs. gap), G428 (≠ N428), G429 (= G429)
- binding magnesium ion: D458 (= D458), N485 (= N485), E487 (≠ I487)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
29% identity, 91% coverage: 2:560/613 of query aligns to 13:561/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ T263), R292 (= R289), W489 (≠ Y494)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ C405), G401 (= G406), Q402 (≠ G407), H403 (≠ N408), G426 (≠ S431), M428 (= M433), G452 (= G457), D453 (= D458), G454 (= G459), S455 (≠ G460), L483 (≠ Y488), G484 (= G489), M485 (≠ I490), V486 (≠ T491)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G217), G223 (= G218), G224 (= G219), T246 (= T243), L247 (≠ W244), M248 (≠ N245), M263 (≠ R260), L264 (≠ I261), M266 (≠ T263), H267 (≠ Y264), G286 (= G283), R288 (= R285), V293 (≠ I290), D310 (= D308), I311 (≠ V309), D329 (= D330), V330 (≠ A331), M405 (≠ V410), G423 (≠ N428)
- binding magnesium ion: A37 (= A26), T82 (= T71), S83 (= S72), Q122 (= Q117), Y381 (≠ A386), D453 (= D458), M458 (= M463), Q461 (= Q466), N480 (= N485), H482 (≠ I487), K533 (≠ Q533)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
29% identity, 91% coverage: 2:561/613 of query aligns to 98:647/670 of P17597
- A122 (= A26) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ G28) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E48) binding
- S186 (= S90) binding
- P197 (≠ N101) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ Q103) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q117) binding
- K220 (= K130) binding
- R246 (= R156) binding ; binding
- K256 (≠ L166) binding
- G308 (= G218) binding
- TL 331:332 (≠ TW 243:244) binding
- C340 (≠ S252) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ IGTY 261:264) binding
- GVRFD 371:375 (≠ GSRIS 283:287) binding
- DR 376:377 (≠ GR 288:289) binding
- DI 395:396 (≠ DV 308:309) binding
- DV 414:415 (≠ DA 330:331) binding
- QH 487:488 (≠ GN 407:408) binding
- GG 508:509 (≠ NG 428:429) binding
- GAM 511:513 (≠ SPM 431:433) binding
- D538 (= D458) binding
- DGS 538:540 (≠ DGG 458:460) binding
- N565 (= N485) binding
- NQHLGM 565:570 (≠ NHIYGI 485:490) binding
- H567 (≠ I487) binding
- W574 (≠ Y494) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
29% identity, 91% coverage: 2:561/613 of query aligns to 13:562/585 of 5k2oA
- active site: Y33 (≠ V22), G35 (= G24), G36 (≠ A25), A37 (= A26), S38 (≠ N27), E59 (= E48), T82 (= T71), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (≠ L166), M266 (≠ T263), V293 (≠ I290), V400 (≠ C405), G426 (≠ S431), M428 (= M433), D453 (= D458), N480 (= N485), H482 (≠ I487), L483 (≠ Y488), M485 (≠ I490), V486 (≠ T491), W489 (≠ Y494), H558 (= H557)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ T263), R292 (= R289), W489 (≠ Y494)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G217), G223 (= G218), G224 (= G219), T246 (= T243), L247 (≠ W244), M248 (≠ N245), L264 (≠ I261), G286 (= G283), R288 (= R285), D290 (≠ S287), V293 (≠ I290), D310 (= D308), I311 (≠ V309), D329 (= D330), V330 (≠ A331), Q404 (≠ I409), M405 (≠ V410), G423 (≠ N428)
- binding magnesium ion: D453 (= D458), N480 (= N485), H482 (≠ I487)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ C405), G401 (= G406), Q402 (≠ G407), H403 (≠ N408), M428 (= M433), D453 (= D458), G454 (= G459), S455 (≠ G460), N480 (= N485), H482 (≠ I487), L483 (≠ Y488), G484 (= G489), M485 (≠ I490), V486 (≠ T491)
Sites not aligning to the query:
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
28% identity, 90% coverage: 4:554/613 of query aligns to 15:554/598 of 6desA
- active site: Y33 (≠ V22), G35 (= G24), G36 (≠ A25), A37 (= A26), I38 (≠ N27), E59 (= E48), T82 (= T71), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (≠ L166), K229 (≠ D228), M265 (≠ T263), V292 (≠ I290), V408 (≠ C405), L433 (≠ N430), G434 (≠ S431), M436 (= M433), D461 (= D458), N488 (= N485), E490 (≠ I487), Q491 (≠ Y488), M493 (≠ I490), V494 (≠ T491), W497 (≠ Y494), L519 (≠ I519), N524 (≠ G524), V525 (= V525)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ T263), D290 (≠ G288), R291 (= R289), W497 (≠ Y494)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G217), A219 (≠ G218), G220 (= G219), N223 (≠ L222), T245 (= T243), L246 (≠ W244), Q247 (≠ N245), L263 (≠ I261), G285 (= G283), A286 (≠ S284), R287 (= R285), D289 (≠ S287), R291 (= R289), V292 (≠ I290), E318 (≠ Q319), I319 (≠ Q320), N323 (≠ D324), D337 (≠ R337), V338 (≠ L338), Q412 (≠ I409), M413 (≠ V410), G431 (≠ N428)
- binding magnesium ion: D461 (= D458), N488 (= N485), E490 (≠ I487)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ C405), G409 (= G406), Q410 (≠ G407), H411 (≠ N408), G434 (≠ S431), M436 (= M433), G460 (= G457), D461 (= D458), A462 (≠ G459), S463 (≠ G460), N488 (= N485), E490 (≠ I487), Q491 (≠ Y488), G492 (= G489), M493 (≠ I490), V494 (≠ T491)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
28% identity, 90% coverage: 4:554/613 of query aligns to 15:554/598 of 6depA
- active site: Y33 (≠ V22), G35 (= G24), G36 (≠ A25), A37 (= A26), I38 (≠ N27), E59 (= E48), T82 (= T71), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (≠ L166), K229 (≠ D228), M265 (≠ T263), V292 (≠ I290), V408 (≠ C405), L433 (≠ N430), G434 (≠ S431), M436 (= M433), D461 (= D458), N488 (= N485), E490 (≠ I487), Q491 (≠ Y488), M493 (≠ I490), V494 (≠ T491), W497 (≠ Y494), L519 (≠ I519), N524 (≠ G524), V525 (= V525)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ G288), R291 (= R289), M493 (≠ I490), W497 (≠ Y494)
- binding flavin-adenine dinucleotide: R161 (= R156), G218 (= G217), A219 (≠ G218), G220 (= G219), N223 (≠ L222), T245 (= T243), L246 (≠ W244), Q247 (≠ N245), L263 (≠ I261), G264 (= G262), G285 (= G283), A286 (≠ S284), R287 (= R285), D289 (≠ S287), R291 (= R289), V292 (≠ I290), E318 (≠ Q319), I319 (≠ Q320), N323 (≠ D324), D337 (≠ R337), V338 (≠ L338), M413 (≠ V410), G431 (≠ N428)
- binding magnesium ion: D461 (= D458), N488 (= N485), E490 (≠ I487)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ C405), G409 (= G406), Q410 (≠ G407), H411 (≠ N408), G434 (≠ S431), M436 (= M433), G460 (= G457), D461 (= D458), A462 (≠ G459), S463 (≠ G460), M466 (= M463), N488 (= N485), E490 (≠ I487), Q491 (≠ Y488), G492 (= G489), M493 (≠ I490), V494 (≠ T491)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ C405), G409 (= G406), Q410 (≠ G407), H411 (≠ N408), G434 (≠ S431), M436 (= M433), G460 (= G457), D461 (= D458), A462 (≠ G459), S463 (≠ G460), M466 (= M463), N488 (= N485), E490 (≠ I487), Q491 (≠ Y488), G492 (= G489), M493 (≠ I490), V494 (≠ T491)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
29% identity, 91% coverage: 2:561/613 of query aligns to 12:561/582 of 3ea4A
- active site: Y32 (≠ V22), G34 (= G24), G35 (≠ A25), A36 (= A26), S37 (≠ N27), E58 (= E48), T81 (= T71), F120 (= F116), Q121 (= Q117), E122 (= E118), K170 (≠ L166), M265 (≠ T263), V292 (≠ I290), V399 (≠ C405), G425 (≠ S431), M427 (= M433), D452 (= D458), N479 (= N485), H481 (≠ I487), L482 (≠ Y488), M484 (≠ I490), V485 (≠ T491), W488 (≠ Y494), H557 (= H557)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ G288), R291 (= R289), W488 (≠ Y494)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R156), G221 (= G217), G222 (= G218), G223 (= G219), T245 (= T243), L246 (≠ W244), M247 (≠ N245), L263 (≠ I261), G264 (= G262), M265 (≠ T263), H266 (≠ Y264), G285 (= G283), R287 (= R285), D289 (≠ S287), R291 (= R289), D309 (= D308), I310 (≠ V309), G327 (≠ C329), D328 (= D330), V329 (≠ A331), M404 (≠ V410), G422 (≠ N428)
- binding magnesium ion: D452 (= D458), N479 (= N485), H481 (≠ I487)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ C405), G400 (= G406), Q401 (≠ G407), H402 (≠ N408), M427 (= M433), G451 (= G457), D452 (= D458), G453 (= G459), S454 (≠ G460), N479 (= N485), H481 (≠ I487), L482 (≠ Y488), G483 (= G489), M484 (≠ I490), V485 (≠ T491)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
29% identity, 91% coverage: 2:561/613 of query aligns to 12:561/582 of 3e9yA
- active site: Y32 (≠ V22), G34 (= G24), G35 (≠ A25), A36 (= A26), S37 (≠ N27), E58 (= E48), T81 (= T71), F120 (= F116), Q121 (= Q117), E122 (= E118), K170 (≠ L166), M265 (≠ T263), V292 (≠ I290), V399 (≠ C405), G425 (≠ S431), M427 (= M433), D452 (= D458), N479 (= N485), H481 (≠ I487), L482 (≠ Y488), M484 (≠ I490), V485 (≠ T491), W488 (≠ Y494), H557 (= H557)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ G288), R291 (= R289), W488 (≠ Y494)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R156), G221 (= G217), G222 (= G218), G223 (= G219), T245 (= T243), L246 (≠ W244), M247 (≠ N245), L263 (≠ I261), G285 (= G283), R287 (= R285), D289 (≠ S287), R291 (= R289), D309 (= D308), I310 (≠ V309), G327 (≠ C329), D328 (= D330), V329 (≠ A331), M404 (≠ V410), G422 (≠ N428)
- binding magnesium ion: D452 (= D458), N479 (= N485), H481 (≠ I487)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ C405), G400 (= G406), Q401 (≠ G407), H402 (≠ N408), M427 (= M433), G451 (= G457), G453 (= G459), S454 (≠ G460), N479 (= N485), H481 (≠ I487), L482 (≠ Y488), G483 (= G489), M484 (≠ I490), V485 (≠ T491)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
29% identity, 91% coverage: 2:561/613 of query aligns to 13:562/583 of 5k3sA
- active site: Y33 (≠ V22), G35 (= G24), G36 (≠ A25), A37 (= A26), S38 (≠ N27), E59 (= E48), T82 (= T71), F121 (= F116), Q122 (= Q117), E123 (= E118), K171 (≠ L166), M266 (≠ T263), V293 (≠ I290), V400 (≠ C405), G426 (≠ S431), M428 (= M433), D453 (= D458), N480 (= N485), H482 (≠ I487), L483 (≠ Y488), M485 (≠ I490), V486 (≠ T491), W489 (≠ Y494), H558 (= H557)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R289), M485 (≠ I490), W489 (≠ Y494)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G217), G223 (= G218), G224 (= G219), T246 (= T243), L247 (≠ W244), M248 (≠ N245), L264 (≠ I261), M266 (≠ T263), G286 (= G283), R288 (= R285), D290 (≠ S287), V293 (≠ I290), D310 (= D308), I311 (≠ V309), D329 (= D330), V330 (≠ A331), M405 (≠ V410), G423 (≠ N428)
- binding magnesium ion: D453 (= D458), N480 (= N485), H482 (≠ I487)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ C405), G401 (= G406), Q402 (≠ G407), H403 (≠ N408), G426 (≠ S431), M428 (= M433), D453 (= D458), G454 (= G459), S455 (≠ G460), N480 (= N485), H482 (≠ I487), L483 (≠ Y488), G484 (= G489), M485 (≠ I490), V486 (≠ T491)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
29% identity, 91% coverage: 2:561/613 of query aligns to 13:562/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ C405), G401 (= G406), Q402 (≠ G407), H403 (≠ N408), G426 (≠ S431), M428 (= M433), G452 (= G457), D453 (= D458), G454 (= G459), S455 (≠ G460), M458 (= M463), N480 (= N485), H482 (≠ I487), L483 (≠ Y488), G484 (= G489), M485 (≠ I490), V486 (≠ T491)
- binding flavin-adenine dinucleotide: R161 (= R156), G222 (= G217), G223 (= G218), G224 (= G219), T246 (= T243), L247 (≠ W244), M248 (≠ N245), L264 (≠ I261), M266 (≠ T263), H267 (≠ Y264), G286 (= G283), V287 (≠ S284), R288 (= R285), D290 (≠ S287), R292 (= R289), V293 (≠ I290), D310 (= D308), I311 (≠ V309), D329 (= D330), V330 (≠ A331), M405 (≠ V410), G423 (≠ N428)
- binding magnesium ion: F370 (≠ L372), D453 (= D458), M458 (= M463), Q461 (= Q466), N480 (= N485), H482 (≠ I487), K533 (≠ Q533)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ T263), R292 (= R289), M485 (≠ I490), W489 (≠ Y494)
Sites not aligning to the query:
Query Sequence
>WP_011383235.1 AMB_RS04050 thiamine pyrophosphate-binding protein
MKVGDYVINRLAEEGIDKIFVVYGAANGDLIDAFTRTNKTEYVATMHEQGGGFAAEAYAK
IKGIPGATIATSGPGGQNLLTSMGNCFYDSIPCVFMTGQINSQFLRPDPSIRQVGFQETD
IVGMAKPVTKYAKMITSAAEIRYEVEKALFIAKEGRPGPVLLDIPLNIQKQDIDPDKLFG
FDTVAAQRSWNLDAVDAAIDTYLADLAKSKRPTIMVGGGVRLANAVDDLVELGEVLGVPM
FPTWNALDVVTSDLPQYGGRIGTYGGAGRNFGIQNSDLLLAVGSRISGRITGGNIHSFAR
EAKKYVVDVDETLLQKHLQQVPLDVNVLCDAGIFLRRLVARAKALRANGGLGDHKAWLSK
VLDWRDRYDPVLPEFFEQKGTVHPYAFVRKLSEMMKGGDIVVGDCGGNIVVTSHAFETKR
GQRLLTNNGNSPMGFSFAGAMGAWFAAPNNQVVCIIGDGGMNMNIQELQTFVNYGVKVKT
FILNNHIYGITKAYQETNFNGRAEACGPKGYAPPDFVKIAQAYGVKTVTIETQQEMEAKI
AEVLAADCAVVCDVNMHEYHTYEPRIFGWKTPIEDMYPYLPRDEFRANMLIEPLDDWQNP
AYPDVVQKKTLDP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory