Comparing WP_011383249.1 NCBI__GCF_000009985.1:WP_011383249.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gttA Crystal structure of hpce (see paper)
54% identity, 89% coverage: 25:249/254 of query aligns to 203:419/421 of 1gttA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
36% identity, 80% coverage: 41:244/254 of query aligns to 88:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
36% identity, 80% coverage: 41:244/254 of query aligns to 89:301/303 of 8sutA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
39% identity, 71% coverage: 45:225/254 of query aligns to 71:251/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
39% identity, 71% coverage: 45:225/254 of query aligns to 71:251/290 of 8gsrA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
44% identity, 71% coverage: 66:245/254 of query aligns to 73:248/252 of 3qdfA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
36% identity, 81% coverage: 40:245/254 of query aligns to 65:276/279 of 6v77B
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 99% coverage: 1:252/254 of query aligns to 1:279/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 99% coverage: 1:252/254 of query aligns to 1:279/280 of 6j5xA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
34% identity, 86% coverage: 28:246/254 of query aligns to 45:268/269 of 4dbhA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 84% coverage: 30:242/254 of query aligns to 54:272/277 of 6iymA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
34% identity, 78% coverage: 53:250/254 of query aligns to 26:224/224 of Q6P587
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
34% identity, 73% coverage: 53:237/254 of query aligns to 20:206/216 of 6sbiA
Sites not aligning to the query:
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 85% coverage: 33:248/254 of query aligns to 70:264/264 of 6jvwB
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
34% identity, 74% coverage: 53:241/254 of query aligns to 21:211/218 of 6fogA
Sites not aligning to the query:
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
31% identity, 78% coverage: 48:245/254 of query aligns to 27:231/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
30% identity, 75% coverage: 45:234/254 of query aligns to 16:209/224 of 3v77A
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
30% identity, 81% coverage: 44:248/254 of query aligns to 62:264/265 of 3r6oA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
28% identity, 72% coverage: 53:234/254 of query aligns to 17:222/247 of 1nkqA
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
30% identity, 70% coverage: 41:217/254 of query aligns to 70:246/281 of 2q1dX
>WP_011383249.1 NCBI__GCF_000009985.1:WP_011383249.1
MKRARIAYNGAIHDARVEDGNVVVLADGRRVAEESVVWLPPVAPGTTFALAINYADHAKE
LAFKAPEKPLAFLKGPGTFVGHRAVTRKPADAGFMHYECELAVVIGRTARDVKAKDAYDF
VAGYTVANDYAIRNFLQNYYRPNLRTKNRDGCTVLGPWMVDRDDVADPMSLDISTFVNGA
RVQSGNTRDMVFGVPALIEYLSSFMTLSPGDLILTGTPDGIVDVKPGDEVVTEVEGVGRL
TSFIVDDETYFQRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory