SitesBLAST
Comparing WP_011383294.1 NCBI__GCF_000009985.1:WP_011383294.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
36% identity, 99% coverage: 3:260/261 of query aligns to 2:258/259 of 5zaiC
- active site: A65 (≠ H67), F70 (≠ M72), S82 (≠ A86), R86 (= R90), G110 (≠ A113), E113 (≠ Q116), P132 (= P135), E133 (≠ G136), I138 (≠ L141), P140 (≠ C143), G141 (≠ S144), A226 (= A228), F236 (≠ M238)
- binding coenzyme a: K24 (≠ A26), L25 (≠ R27), A63 (= A65), G64 (= G66), A65 (≠ H67), D66 (= D68), I67 (≠ L69), P132 (= P135), R166 (≠ P168), F248 (= F250), K251 (= K253)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
36% identity, 97% coverage: 5:258/261 of query aligns to 4:254/255 of 3q0jC
- active site: A65 (≠ H67), M70 (= M72), T80 (≠ A82), F84 (= F85), G108 (≠ A113), E111 (≠ Q116), P130 (= P135), E131 (≠ G136), V136 (≠ L141), P138 (= P146), G139 (≠ M147), L224 (≠ A228), F234 (≠ M238)
- binding acetoacetyl-coenzyme a: Q23 (≠ E25), A24 (= A26), L25 (≠ R27), A27 (= A29), A63 (= A65), G64 (= G66), A65 (≠ H67), D66 (= D68), I67 (≠ L69), K68 (= K70), M70 (= M72), F84 (= F85), G107 (≠ A112), G108 (≠ A113), E111 (≠ Q116), P130 (= P135), E131 (≠ G136), P138 (= P146), G139 (≠ M147), M140 (≠ V148)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
36% identity, 97% coverage: 5:258/261 of query aligns to 4:254/255 of 3q0gC
- active site: A65 (≠ H67), M70 (= M72), T80 (≠ A82), F84 (= F85), G108 (≠ A113), E111 (≠ Q116), P130 (= P135), E131 (≠ G136), V136 (≠ L141), P138 (= P146), G139 (≠ M147), L224 (≠ A228), F234 (≠ M238)
- binding coenzyme a: L25 (≠ R27), A63 (= A65), I67 (≠ L69), K68 (= K70), Y104 (≠ M109), P130 (= P135), E131 (≠ G136), L134 (≠ I139)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
36% identity, 97% coverage: 5:258/261 of query aligns to 3:253/256 of 3h81A
- active site: A64 (≠ H67), M69 (= M72), T79 (≠ A82), F83 (= F85), G107 (≠ A113), E110 (≠ Q116), P129 (= P135), E130 (≠ G136), V135 (≠ L141), P137 (= P146), G138 (≠ M147), L223 (≠ A228), F233 (≠ M238)
- binding calcium ion: F233 (≠ M238), Q238 (≠ A243)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
36% identity, 97% coverage: 5:258/261 of query aligns to 3:249/250 of 3q0gD
- active site: A64 (≠ H67), M69 (= M72), T75 (≠ A82), F79 (= F85), G103 (≠ A113), E106 (≠ Q116), P125 (= P135), E126 (≠ G136), V131 (≠ L141), P133 (= P146), G134 (≠ M147), L219 (≠ A228), F229 (≠ M238)
- binding Butyryl Coenzyme A: F225 (≠ M234), F241 (= F250)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
36% identity, 93% coverage: 16:259/261 of query aligns to 17:258/260 of 2hw5C
- active site: A68 (≠ H67), M73 (= M72), S83 (≠ A82), L87 (≠ A86), G111 (≠ A113), E114 (≠ Q116), P133 (= P135), E134 (≠ G136), T139 (≠ L141), P141 (≠ C143), G142 (≠ S144), K227 (≠ A228), F237 (≠ M238)
- binding crotonyl coenzyme a: K26 (≠ E25), A27 (= A26), L28 (≠ R27), A30 (= A29), K62 (≠ P61), I70 (≠ L69), F109 (≠ T111)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
36% identity, 94% coverage: 14:259/261 of query aligns to 14:252/254 of 2dubA
- active site: A67 (≠ H67), M72 (= M72), S82 (≠ R90), G105 (≠ A113), E108 (≠ Q116), P127 (= P135), E128 (≠ G136), T133 (≠ L141), P135 (≠ C143), G136 (≠ S144), K221 (≠ A228), F231 (≠ M238)
- binding octanoyl-coenzyme a: K25 (≠ E25), A26 (= A26), L27 (≠ R27), A29 (= A29), A65 (= A65), A67 (≠ H67), D68 (= D68), I69 (≠ L69), K70 (= K70), G105 (≠ A113), E108 (≠ Q116), P127 (= P135), E128 (≠ G136), G136 (≠ S144), A137 (≠ T145)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
35% identity, 93% coverage: 16:259/261 of query aligns to 15:256/258 of 1ey3A
- active site: A66 (≠ H67), M71 (= M72), S81 (≠ A82), L85 (≠ A86), G109 (≠ A113), E112 (≠ Q116), P131 (= P135), E132 (≠ G136), T137 (≠ L141), P139 (≠ C143), G140 (≠ S144), K225 (≠ A228), F235 (≠ M238)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E25), L26 (≠ R27), A28 (= A29), A64 (= A65), G65 (= G66), A66 (≠ H67), D67 (= D68), I68 (≠ L69), L85 (≠ A86), W88 (≠ M92), G109 (≠ A113), P131 (= P135), L135 (≠ I139), G140 (≠ S144)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
35% identity, 93% coverage: 16:259/261 of query aligns to 17:258/260 of 1dubA
- active site: A68 (≠ H67), M73 (= M72), S83 (≠ A82), L87 (≠ A86), G111 (≠ A113), E114 (≠ Q116), P133 (= P135), E134 (≠ G136), T139 (≠ L141), P141 (≠ C143), G142 (≠ S144), K227 (≠ A228), F237 (≠ M238)
- binding acetoacetyl-coenzyme a: K26 (≠ E25), A27 (= A26), L28 (≠ R27), A30 (= A29), A66 (= A65), A68 (≠ H67), D69 (= D68), I70 (≠ L69), Y107 (≠ M109), G110 (≠ A112), G111 (≠ A113), E114 (≠ Q116), P133 (= P135), E134 (≠ G136), L137 (≠ I139), G142 (≠ S144), F233 (≠ M234), F249 (= F250)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
35% identity, 94% coverage: 14:259/261 of query aligns to 45:288/290 of P14604
- E144 (≠ Q116) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ G136) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
35% identity, 93% coverage: 16:259/261 of query aligns to 17:256/258 of 1mj3A
- active site: A68 (≠ H67), M73 (= M72), S83 (≠ R90), L85 (≠ M92), G109 (≠ A113), E112 (≠ Q116), P131 (= P135), E132 (≠ G136), T137 (≠ L141), P139 (≠ C143), G140 (≠ S144), K225 (≠ A228), F235 (≠ M238)
- binding hexanoyl-coenzyme a: K26 (≠ E25), A27 (= A26), L28 (≠ R27), A30 (= A29), A66 (= A65), G67 (= G66), A68 (≠ H67), D69 (= D68), I70 (≠ L69), G109 (≠ A113), P131 (= P135), E132 (≠ G136), L135 (≠ I139), G140 (≠ S144)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
34% identity, 92% coverage: 19:259/261 of query aligns to 24:266/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 97% coverage: 7:260/261 of query aligns to 4:256/257 of 6slbAAA
- active site: Q64 (≠ H67), F69 (≠ M72), L80 (≠ F85), N84 (≠ S89), A108 (= A113), S111 (≠ Q116), A130 (≠ P135), F131 (≠ G136), L136 (= L141), P138 (≠ C143), D139 (≠ S144), A224 (= A228), G234 (≠ M238)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ P61), A62 (= A65), Q64 (≠ H67), D65 (= D68), L66 (= L69), Y76 (≠ V81), A108 (= A113), F131 (≠ G136), D139 (≠ S144)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 97% coverage: 7:260/261 of query aligns to 1:244/245 of 6slaAAA
- active site: Q61 (≠ H67), L68 (≠ F85), N72 (≠ S89), A96 (= A113), S99 (≠ Q116), A118 (≠ P135), F119 (≠ G136), L124 (= L141), P126 (≠ C143), N127 (≠ S144), A212 (= A228), G222 (≠ M238)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R27), A59 (= A65), Q61 (≠ H67), D62 (= D68), L63 (= L69), L68 (≠ F85), Y71 (≠ C88), A94 (≠ T111), G95 (≠ A112), A96 (= A113), F119 (≠ G136), I122 (= I139), L124 (= L141), N127 (≠ S144), F234 (= F250), K237 (= K253)
3omeC Crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis (see paper)
34% identity, 79% coverage: 16:221/261 of query aligns to 14:217/247 of 3omeC
- active site: H65 (= H67), E70 (≠ D79), A82 (≠ C88), L86 (≠ M92), G110 (≠ A113), L113 (≠ Q116), V133 (≠ G136), I138 (≠ L141), G139 (≠ C143), E142 (≠ P146)
- binding zinc ion: E81 (vs. gap), E142 (≠ P146)
Sites not aligning to the query:
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
34% identity, 93% coverage: 15:256/261 of query aligns to 17:251/260 of 2uzfA
- active site: G70 (≠ H67), R80 (≠ A83), L84 (= L87), G108 (≠ A113), V111 (≠ Q116), T130 (≠ P135), G131 (= G136), S136 (≠ L141), D138 (vs. gap), A139 (≠ C143), A225 (= A230), Y233 (≠ M238)
- binding acetoacetyl-coenzyme a: V28 (≠ A26), R29 (= R27), S68 (≠ A65), G69 (= G66), G70 (≠ H67), D71 (= D68), Y104 (≠ M109), G108 (≠ A113)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
34% identity, 93% coverage: 15:256/261 of query aligns to 22:264/273 of Q5HH38
- R34 (= R27) binding in other chain
- SGGDQ 73:77 (≠ AGHDL 65:69) binding in other chain
- S149 (≠ L141) binding in other chain
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 93% coverage: 13:256/261 of query aligns to 84:328/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
3t3wF Crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile (see paper)
36% identity, 79% coverage: 16:221/261 of query aligns to 14:218/248 of 3t3wF
- active site: H65 (= H67), D71 (= D79), S83 (vs. gap), L87 (≠ M92), G111 (≠ A113), L114 (≠ Q116), V134 (≠ G136), I139 (= I139), G140 (= G140), E143 (≠ P146)
- binding zinc ion: E82 (vs. gap), E143 (≠ P146)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
33% identity, 92% coverage: 20:260/261 of query aligns to 19:260/261 of 5jbxB
- active site: A67 (≠ H67), R72 (= R73), L84 (≠ F85), R88 (≠ S89), G112 (≠ A113), E115 (≠ Q116), T134 (≠ P135), E135 (≠ G136), I140 (≠ L141), P142 (≠ C143), G143 (≠ S144), A228 (= A228), L238 (≠ M238)
- binding coenzyme a: S24 (≠ E25), R25 (≠ A26), R26 (= R27), A28 (= A29), A65 (= A65), D68 (= D68), L69 (= L69), K70 (= K70), L110 (≠ T111), G111 (≠ A112), T134 (≠ P135), E135 (≠ G136), L138 (≠ I139), R168 (≠ P168)
Query Sequence
>WP_011383294.1 NCBI__GCF_000009985.1:WP_011383294.1
MSELETILLRRDEAGVATLTLNRPEARNALSVALMSELDSELARIARDPAVRVVVLAANG
PAFCAGHDLKEMRALQGRDEVAAVFALCSRVMTAIVRLPQPVIAKVHAMATAAGCQLVAS
CDLAYAATEAKFATPGVNIGLFCSTPMVALSRGVGRKQAMEMLLSGRPINAGTAERWGLV
NHVVAAEALDSEVASMARLIASKSAHTLKVGKEAFYRQLEMGLDDAYALASKVMTENMLA
MDAAEGIDAFLEKRPPVWRGC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory