SitesBLAST
Comparing WP_011383322.1 NCBI__GCF_000009985.1:WP_011383322.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 98% coverage: 3:246/250 of query aligns to 7:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), S20 (= S16), K21 (≠ S17), G22 (= G18), I23 (= I19), A43 (≠ R39), S44 (≠ N40), S45 (≠ A41), G68 (= G60), D69 (= D61), V70 (= V62), N96 (= N88), S97 (≠ A89), G98 (= G90), Y100 (≠ A92), I144 (≠ V136), S146 (≠ T138), Y159 (= Y151), K163 (= K155), P189 (= P181), G190 (= G182), M191 (≠ P183), I192 (= I184), T194 (= T186), G196 (≠ I188), T197 (≠ W189)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (≠ T138), Y159 (= Y151), M191 (≠ P183), I202 (≠ L194)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
37% identity, 97% coverage: 4:246/250 of query aligns to 2:243/251 of 4esoB
- active site: G16 (= G18), S136 (≠ T138), M146 (≠ L148), Y149 (= Y151), K153 (= K155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), T14 (≠ S16), H15 (≠ S17), M17 (≠ I19), R37 (= R39), N38 (= N40), N41 (≠ A43), S58 (≠ G60), D59 (= D61), I60 (≠ V62), N86 (= N88), A87 (= A89), G88 (= G90), T134 (≠ V136), S136 (≠ T138), Y149 (= Y151), P179 (= P181), G180 (= G182), I182 (= I184), T184 (= T186), T186 (≠ I188), K187 (≠ W189), G188 (= G190)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
39% identity, 98% coverage: 5:248/250 of query aligns to 4:247/249 of 4bmsF
- active site: S137 (≠ T138), H147 (≠ L148), Y150 (= Y151), K154 (= K155), Q195 (≠ G193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ S16), S16 (= S17), I18 (= I19), R38 (= R39), R39 (≠ N40), A59 (≠ G60), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (= V111), S137 (≠ T138), Y150 (= Y151), K154 (= K155), G181 (= G182), I183 (= I184), T185 (= T186), I187 (= I188)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
39% identity, 98% coverage: 5:248/250 of query aligns to 4:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (≠ T138), H147 (≠ L148), Y150 (= Y151), L188 (≠ W189), L246 (≠ Y247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ S16), S16 (= S17), G17 (= G18), I18 (= I19), R38 (= R39), R39 (≠ N40), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (= V111), T135 (≠ V136), S137 (≠ T138), Y150 (= Y151), K154 (= K155), P180 (= P181), G181 (= G182), A182 (≠ P183), I183 (= I184), T185 (= T186), S187 (≠ I188)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
36% identity, 99% coverage: 1:248/250 of query aligns to 1:251/261 of 1g6kA
- active site: G18 (= G18), S145 (≠ T138), Y158 (= Y151), K162 (= K155)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S17), G18 (= G18), L19 (≠ I19), R39 (= R39), D65 (= D61), V66 (= V62), N92 (= N88), A93 (= A89), G94 (= G90), M143 (≠ V136), S145 (≠ T138), Y158 (= Y151), P188 (= P181), G189 (= G182), I191 (= I184), T193 (= T186)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
40% identity, 100% coverage: 1:249/250 of query aligns to 3:251/259 of 6ci9D
- active site: G20 (= G18), S145 (≠ F139), Y159 (= Y151)
- binding 1-aminopropan-2-one: F97 (≠ A92), S145 (≠ F139), T147 (= T141), W156 (≠ L148), Y159 (= Y151), G190 (= G182)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), S18 (= S16), G20 (= G18), I21 (= I19), G40 (≠ A38), R41 (= R39), N42 (= N40), D66 (= D61), V67 (= V62), N93 (= N88), G95 (= G90), T143 (= T137), S145 (≠ F139), Y159 (= Y151), K163 (= K155), P189 (= P181), N191 (≠ P183), I192 (= I184), T194 (= T186), G196 (≠ I188), L197 (≠ W189)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
36% identity, 99% coverage: 1:248/250 of query aligns to 1:251/261 of P40288
- 11:35 (vs. 11:35, 52% identical) binding
- E96 (≠ A92) mutation E->A,G,K: Heat stable.
- D108 (≠ A104) mutation to N: Heat stable.
- V112 (≠ Q108) mutation to A: Heat stable.
- E133 (≠ Q129) mutation to K: Heat stable.
- V183 (= V176) mutation to I: Heat stable.
- P194 (= P187) mutation to Q: Heat stable.
- E210 (≠ T207) mutation to K: Heat stable.
- Y217 (≠ A214) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
36% identity, 99% coverage: 4:250/250 of query aligns to 8:256/257 of 5fffA
- active site: K206 (≠ A196)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ A92), H158 (≠ L148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), T20 (≠ S16), G22 (= G18), I23 (= I19), R43 (= R39), C67 (vs. gap), D68 (= D61), V69 (= V62), N96 (= N88), I146 (≠ V136), Y161 (= Y151), K165 (= K155), P191 (= P181), A193 (≠ P183), I194 (= I184), T196 (= T186), G198 (≠ I188), T199 (≠ W189)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
36% identity, 99% coverage: 4:250/250 of query aligns to 8:256/257 of 5ff9B
- active site: K206 (≠ A196)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ A92), I155 (≠ F145), H158 (≠ L148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), T20 (≠ S16), K21 (≠ S17), I23 (= I19), S42 (≠ A38), R43 (= R39), C67 (vs. gap), D68 (= D61), V69 (= V62), N96 (= N88), I146 (≠ V136), S148 (≠ T138), Y161 (= Y151), K165 (= K155), P191 (= P181), A193 (≠ P183), I194 (= I184), T196 (= T186), G198 (≠ I188), T199 (≠ W189)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
36% identity, 99% coverage: 4:250/250 of query aligns to 8:256/257 of A0A1A9TAK5
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
36% identity, 99% coverage: 1:248/250 of query aligns to 7:257/267 of 3ay6B
- active site: G24 (= G18), S151 (≠ T138), Y164 (= Y151), K168 (= K155)
- binding beta-D-glucopyranose: E102 (≠ A92), S151 (≠ T138), H153 (≠ L140), W158 (≠ F145), Y164 (= Y151), N202 (≠ S191), K205 (≠ L194)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), T23 (≠ S17), G24 (= G18), L25 (≠ I19), Y45 (≠ A38), D71 (= D61), V72 (= V62), N98 (= N88), A99 (= A89), G100 (= G90), V101 (≠ I91), M149 (≠ V136), S151 (≠ T138), Y164 (= Y151), K168 (= K155), P194 (= P181), G195 (= G182), M197 (≠ I184), T199 (= T186), P200 (= P187), I201 (= I188), N202 (≠ S191)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
36% identity, 97% coverage: 5:246/250 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ F145) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ L148) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (= T164) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
37% identity, 99% coverage: 1:248/250 of query aligns to 1:250/252 of Q6WVP7
Sites not aligning to the query:
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
36% identity, 97% coverage: 5:246/250 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G18), S145 (≠ T138), F155 (≠ L148), Y158 (= Y151), K162 (= K155), K203 (≠ A196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G14), T17 (≠ S16), D18 (≠ S17), G19 (= G18), I20 (= I19), S39 (≠ A38), R40 (= R39), K41 (≠ N40), N44 (≠ A43), H65 (vs. gap), V66 (vs. gap), N92 (= N88), A94 (≠ G90), S145 (≠ T138), Y158 (= Y151), K162 (= K155), P188 (= P181), G189 (= G182), L190 (≠ P183), I191 (= I184), T193 (= T186), F195 (≠ I188), S196 (≠ W189)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
37% identity, 99% coverage: 1:248/250 of query aligns to 2:251/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (≠ T138), I145 (≠ F139), E146 (≠ L140), Y157 (= Y151), V197 (≠ W189), F207 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), T17 (≠ S16), I20 (= I19), R40 (= R39), H41 (≠ N40), D64 (= D61), A65 (≠ V62), N91 (= N88), A92 (= A89), V114 (= V111), M142 (≠ V136), S144 (≠ T138), Y157 (= Y151), K161 (= K155), P189 (= P181), G190 (= G182), P191 (= P183), I192 (= I184), T194 (= T186), P195 (= P187), L196 (≠ I188)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
35% identity, 96% coverage: 8:248/250 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G18), S142 (≠ T138), Y155 (= Y151), K159 (= K155)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (= F145), R152 (≠ L148), Y155 (= Y151), W195 (= W189), R196 (≠ S191)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), S12 (= S17), G13 (= G18), N14 (≠ I19), D33 (≠ A38), L34 (≠ R39), A59 (≠ G60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I140 (≠ V136), P185 (= P181), G186 (= G182), M187 (≠ P183), I188 (= I184), T190 (= T186), P191 (= P187), M192 (≠ I188), T193 (vs. gap)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
35% identity, 96% coverage: 8:248/250 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ SGI 17:19) binding
- D33 (≠ A38) binding
- DV 60:61 (= DV 61:62) binding
- N87 (= N88) binding
- S142 (≠ T138) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ L148) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y151) mutation Y->E,F: Loss of activity.
- K159 (= K155) mutation to A: Loss of activity.
- R179 (= R175) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IGTPI 184:188) binding
- W-R 195:196 (≠ WGS 189:191) binding
- R196 (≠ S191) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ A203) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R209) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
37% identity, 99% coverage: 2:248/250 of query aligns to 1:249/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (≠ T138), I143 (≠ F139), Y155 (= Y151), F205 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ S16), L16 (≠ S17), G17 (= G18), I18 (= I19), R38 (= R39), H39 (≠ N40), D62 (= D61), A63 (≠ V62), N89 (= N88), A90 (= A89), V112 (= V111), M140 (≠ V136), S142 (≠ T138), Y155 (= Y151), K159 (= K155), P187 (= P181), P189 (= P183), I190 (= I184), T192 (= T186), P193 (= P187), L194 (≠ I188)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
32% identity, 98% coverage: 1:246/250 of query aligns to 1:241/245 of 5t5qC
- active site: G18 (= G18), S140 (≠ T138), N150 (≠ L148), Y153 (= Y151), K157 (= K155)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ S16), G17 (≠ S17), G18 (= G18), I19 (= I19), D38 (≠ A38), L39 (≠ R39), D63 (= D61), A64 (≠ V62), S90 (≠ N88), I113 (≠ V111), Y153 (= Y151), K157 (= K155), P182 (= P181), I185 (= I184), T187 (= T186), M189 (≠ L194)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
33% identity, 96% coverage: 8:246/250 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 11:38, 50% identical) binding
- D59 (= D61) binding
- K156 (= K155) binding
Query Sequence
>WP_011383322.1 NCBI__GCF_000009985.1:WP_011383322.1
MTSSLSGKVAVVTGASSGIGHAIAQRFLAEGAKVAVFARNAAALADLAKGREDSVLAVTG
DVTCAADLERLVAETVKRFGGVDMVIPNAGIAKVVPFEQSDAAAIDHQFAVNFTGAVQTV
RGFLPHIRQGGSVLFVTTFLTQVGFPGLAIYSASKAALKSFSQTLAAELAPKGIRVNSVA
PGPIGTPIWGSIGLPADVLQAVATQVTARLMPGAFGEPGDIAATAAFLCSDQAKNIWGQE
IVVDGGYTIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory