Comparing WP_011383337.1 NCBI__GCF_000009985.1:WP_011383337.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
41% identity, 95% coverage: 7:325/337 of query aligns to 13:330/336 of A3QCW5
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 91% coverage: 26:332/337 of query aligns to 4:309/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 91% coverage: 26:332/337 of query aligns to 3:308/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 91% coverage: 26:332/337 of query aligns to 3:308/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 91% coverage: 26:332/337 of query aligns to 3:308/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 91% coverage: 26:332/337 of query aligns to 3:308/310 of 7bcnA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
37% identity, 86% coverage: 36:324/337 of query aligns to 12:297/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
37% identity, 86% coverage: 36:324/337 of query aligns to 13:298/304 of 4pakA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
37% identity, 88% coverage: 29:324/337 of query aligns to 3:295/301 of 4pdhA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
33% identity, 88% coverage: 29:323/337 of query aligns to 3:294/303 of 4pddA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
34% identity, 87% coverage: 31:323/337 of query aligns to 6:304/314 of 4p8bA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
36% identity, 68% coverage: 38:265/337 of query aligns to 13:241/304 of 4x8rA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
30% identity, 83% coverage: 30:310/337 of query aligns to 4:280/304 of 4xeqB
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
32% identity, 71% coverage: 28:267/337 of query aligns to 7:247/312 of 4oanA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
31% identity, 81% coverage: 55:326/337 of query aligns to 30:297/300 of 7t3eA
Sites not aligning to the query:
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
31% identity, 88% coverage: 30:324/337 of query aligns to 6:300/308 of 4mmpA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
28% identity, 91% coverage: 10:315/337 of query aligns to 11:312/328 of Q0B2F6
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
31% identity, 77% coverage: 29:288/337 of query aligns to 3:262/301 of 4nq8B
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
32% identity, 84% coverage: 44:325/337 of query aligns to 18:299/305 of 4mnpA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 80% coverage: 1:268/337 of query aligns to 2:267/329 of P44542
>WP_011383337.1 NCBI__GCF_000009985.1:WP_011383337.1
MKLGTLIAGAIAACVLAGSAMAQQAQPIVIKFSHVVAPDTPKGKGAEYFKKLAEERTKGR
VKVEVYPNSQLYKDKEEMEALQLGAVQMLAPSLAKFGPLGVKEFEVFDLPYIFPSKDVLR
SVTGGPVGASLLKKLEGKGIIGLAYWDNGFKIMSANKPIKAPSDLKGVKMRIQSSKVLDA
EMRALGALPQVMAFSEVYQALQTGVVDGTENPPSNMYTQKMHEVQKHATMTNHGYLGYAV
IVNKKFWEGLPADIRATLEGAMSEASVFANAIAQTENDDAVKAMKASGKTEFHDPSAAEI
EAWRKALLPVHKDMEGRVGKDLIESFYKEAAKFGFKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory