Comparing WP_011383513.1 NCBI__GCF_000009985.1:WP_011383513.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
42% identity, 90% coverage: 28:293/297 of query aligns to 44:314/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
42% identity, 90% coverage: 28:293/297 of query aligns to 41:311/316 of 3nioA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
41% identity, 98% coverage: 2:291/297 of query aligns to 20:309/318 of Q9I6K2
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
41% identity, 98% coverage: 2:291/297 of query aligns to 18:307/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
41% identity, 98% coverage: 2:291/297 of query aligns to 17:306/315 of 3niqA
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
41% identity, 93% coverage: 22:296/297 of query aligns to 33:304/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
41% identity, 93% coverage: 22:296/297 of query aligns to 23:294/294 of 7lolA
7lbaB E. Coli agmatinase (see paper)
41% identity, 86% coverage: 22:276/297 of query aligns to 40:291/310 of 7lbaB
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
44% identity, 88% coverage: 30:291/297 of query aligns to 54:314/323 of 4dz4B
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
40% identity, 89% coverage: 25:288/297 of query aligns to 33:305/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
40% identity, 89% coverage: 25:288/297 of query aligns to 25:297/301 of 1gq6B
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
41% identity, 93% coverage: 22:296/297 of query aligns to 19:284/284 of 7loxA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
32% identity, 90% coverage: 20:285/297 of query aligns to 73:347/378 of 7esrA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
30% identity, 87% coverage: 26:284/297 of query aligns to 25:275/284 of Q57757
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
32% identity, 91% coverage: 22:292/297 of query aligns to 23:285/293 of 3pzlB
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
27% identity, 93% coverage: 22:297/297 of query aligns to 5:275/276 of 3lhlA
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
37% identity, 62% coverage: 103:287/297 of query aligns to 151:331/338 of G7JFU5
Sites not aligning to the query:
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
37% identity, 62% coverage: 103:287/297 of query aligns to 130:310/317 of 6vstA
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
37% identity, 62% coverage: 103:287/297 of query aligns to 133:313/320 of 6vstD
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
27% identity, 89% coverage: 25:289/297 of query aligns to 41:313/321 of 3m1rD
>WP_011383513.1 NCBI__GCF_000009985.1:WP_011383513.1
MLPTFSLPPRFLGGCASDPGTATFCIAGIPFDLGVTNRSGAREGPQAVRRASRMLADGAN
PAGWSDPAQMSIADLGDFSLALGDIPRSLEMIEQQAAGIGHLLAVGGDHTITLALLRALV
KRTGPVGLVHFDAHIDTWPDNFGQKLAHGSPFFHALREGLVDPRRMIQIGIRSPMPREVY
DWTVGQGVTIVTAEQVHAQGPQWVAEAIGRVVGEGLTYLSFDIDAIDPGQAPGTGTPEVG
GLFTWQVMAILRRLAGLRFVGMDVVEVAPAYDVSEITALAAASILWQYLTLRPLDKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory