SitesBLAST
Comparing WP_011383647.1 NCBI__GCF_000009985.1:WP_011383647.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
39% identity, 94% coverage: 6:423/444 of query aligns to 4:456/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
39% identity, 94% coverage: 6:423/444 of query aligns to 5:457/485 of Q8DLI5
- R6 (= R7) binding
- Y192 (= Y185) binding
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
34% identity, 98% coverage: 6:439/444 of query aligns to 5:457/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 98% coverage: 6:439/444 of query aligns to 5:457/471 of P04805
- C98 (= C98) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ E100) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (vs. gap) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ R123) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ A125) mutation to Q: No change in activity or in zinc content.
- H131 (≠ K127) mutation to Q: No change in activity or in zinc content.
- H132 (≠ L128) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A134) mutation to S: No change in activity or in zinc content.
- S239 (= S243) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
35% identity, 70% coverage: 6:315/444 of query aligns to 4:325/485 of 4griB
- active site: S9 (= S11), K253 (= K244)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (≠ D43), Y194 (= Y185), R212 (= R203), W216 (≠ H207)
- binding zinc ion: C105 (= C98), C107 (≠ E100), Y128 (= Y121), C132 (≠ A125)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
34% identity, 78% coverage: 1:345/444 of query aligns to 1:351/488 of 8vc5A
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
36% identity, 70% coverage: 7:318/444 of query aligns to 6:299/380 of 4g6zA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 2cv2A
- active site: K246 (= K244)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R7), A7 (= A9), S9 (= S11), G17 (= G19), I21 (≠ V23), E41 (≠ D43), Y187 (= Y185), R205 (= R203), A206 (≠ G204), E208 (≠ D206), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (vs. gap), R163 (= R161), Y168 (= Y166), E172 (≠ N170), V177 (= V175), K180 (≠ R178), S181 (≠ G179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), V211 (≠ T209), R237 (≠ T235), K241 (≠ G239), L272 (≠ K270), M273 (≠ L271), G274 (= G272), E282 (≠ D278), S299 (≠ G296), P303 (= P300), V304 (≠ K301), K309 (≠ E306), W312 (≠ R309), R319 (≠ H316), P357 (= P342), R358 (≠ N343), R417 (≠ E393), Q432 (≠ H408), R435 (= R411), L442 (≠ E418), E443 (≠ N419), T444 (≠ G420), G446 (≠ E422), L447 (= L423), F448 (≠ K424)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 2cv1A
- active site: K246 (= K244)
- binding adenosine-5'-triphosphate: P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ N20), I21 (≠ V23), R47 (= R49), A206 (≠ G204), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R7), A7 (= A9), E41 (≠ D43), Y187 (= Y185), R205 (= R203), W209 (≠ H207)
- binding : S9 (= S11), E41 (≠ D43), T43 (= T45), D44 (= D46), R47 (= R49), V145 (vs. gap), R163 (= R161), V166 (≠ S164), E172 (≠ N170), V177 (= V175), K180 (≠ R178), S181 (≠ G179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), V211 (≠ T209), R237 (≠ T235), K241 (≠ G239), K243 (≠ G241), M273 (≠ L271), G274 (= G272), S276 (= S274), E282 (≠ D278), S299 (≠ G296), P303 (= P300), V304 (≠ K301), K309 (≠ E306), W312 (≠ R309), R319 (≠ H316), P357 (= P342), R358 (≠ N343), R417 (≠ E393), L427 (≠ G403), Q432 (≠ H408), R435 (= R411), L442 (≠ E418), E443 (≠ N419), T444 (≠ G420), G446 (≠ E422), L447 (= L423), F448 (≠ K424)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 1n78A
- active site: K246 (= K244)
- binding glutamol-amp: R5 (= R7), A7 (= A9), P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ N20), I21 (≠ V23), E41 (≠ D43), Y187 (= Y185), N191 (≠ S189), R205 (= R203), A206 (≠ G204), E208 (≠ D206), W209 (≠ H207), L235 (= L233), L236 (= L234)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (vs. gap), R163 (= R161), V166 (≠ S164), Y168 (= Y166), E172 (≠ N170), V177 (= V175), K180 (≠ R178), S181 (≠ G179), Y187 (= Y185), E207 (= E205), E208 (≠ D206), W209 (≠ H207), L210 (≠ V208), V211 (≠ T209), R237 (≠ T235), K241 (≠ G239), M273 (≠ L271), G274 (= G272), E282 (≠ D278), R297 (≠ K294), P303 (= P300), V304 (≠ K301), K309 (≠ E306), W312 (≠ R309), R319 (≠ H316), P357 (= P342), R358 (≠ N343), R417 (≠ E393), L427 (≠ G403), Q432 (≠ H408), R435 (= R411), L442 (≠ E418), E443 (≠ N419), T444 (≠ G420), G446 (≠ E422), L447 (= L423), F448 (≠ K424)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 1j09A
- active site: K246 (= K244)
- binding adenosine-5'-triphosphate: H15 (= H17), E208 (≠ D206), L235 (= L233), L236 (= L234), K243 (≠ G241), I244 (≠ L242), S245 (= S243), K246 (= K244), R247 (= R245)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (≠ D43), Y187 (= Y185), N191 (≠ S189), R205 (= R203), W209 (≠ H207)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of P27000
- R358 (≠ N343) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 98% coverage: 5:439/444 of query aligns to 3:463/468 of 1g59A
- binding : D44 (= D46), R45 (≠ L47), A46 (≠ E48), R47 (= R49), P109 (= P102), V145 (vs. gap), R163 (= R161), V166 (≠ S164), E172 (≠ N170), V177 (= V175), K180 (≠ R178), S181 (≠ G179), D182 (= D180), E207 (= E205), E208 (≠ D206), R237 (≠ T235), K241 (≠ G239), T242 (≠ E240), K243 (≠ G241), M273 (≠ L271), G274 (= G272), E282 (≠ D278), S299 (≠ G296), L300 (≠ R297), P303 (= P300), V304 (≠ K301), K309 (≠ E306), W312 (≠ R309), R319 (≠ H316), P357 (= P342), R358 (≠ N343), R417 (≠ E393), K426 (= K402), L427 (≠ G403), Q432 (≠ H408), R435 (= R411), L442 (≠ E418), E443 (≠ N419), T444 (≠ G420), P445 (= P421), G446 (≠ E422), L447 (= L423), F448 (≠ K424)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 98% coverage: 6:439/444 of query aligns to 105:555/564 of 3al0C
- active site: S110 (= S11), K335 (= K244)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R7), A108 (= A9), P109 (= P10), G118 (= G19), T122 (≠ V23), E142 (≠ D43), Y276 (= Y185), R294 (= R203), G295 (= G204), D297 (= D206), H298 (= H207), L324 (= L233), I325 (≠ L234), L333 (= L242)
- binding : T144 (= T45), D145 (= D46), R148 (= R49), Y208 (= Y99), P213 (≠ E104), K252 (≠ R161), M255 (≠ S164), I266 (≠ V175), K269 (≠ R178), S270 (≠ G179), Y276 (= Y185), D297 (= D206), H298 (= H207), L299 (≠ V208), S300 (≠ T209), N301 (= N210), K304 (≠ P213), R330 (≠ G239), P332 (≠ G241), G363 (= G272), W364 (≠ S273), R365 (≠ S274), E370 (≠ I279), S387 (≠ G296), K389 (≠ G298), V391 (≠ P300), I392 (≠ K301), K397 (≠ E306), W400 (≠ R309), R407 (≠ H316), E446 (≠ P342), K447 (≠ N343), Q453 (≠ E349), I457 (≠ A352), R509 (= R401), K520 (= K404), Q524 (≠ H408), R527 (= R411), V535 (≠ N419), T536 (≠ G420), G538 (≠ E422), L539 (= L423)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
28% identity, 98% coverage: 6:439/444 of query aligns to 5:494/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 61% coverage: 5:276/444 of query aligns to 12:282/455 of 3aiiA
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
36% identity, 55% coverage: 2:245/444 of query aligns to 2:230/290 of 4a91A
- active site: S11 (= S11), K229 (= K244)
- binding glutamic acid: R7 (= R7), A9 (= A9), S11 (= S11), E43 (≠ D43), Y170 (= Y185), R188 (= R203), L192 (≠ H207)
- binding zinc ion: C99 (= C98), C101 (≠ E100), Y113 (≠ P118), C117 (≠ D122)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 55% coverage: 2:245/444 of query aligns to 14:242/308 of P27305
- E55 (≠ D43) binding
- Y182 (= Y185) binding
- R200 (= R203) binding
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 50% coverage: 1:221/444 of query aligns to 199:418/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>WP_011383647.1 NCBI__GCF_000009985.1:WP_011383647.1
MTSPVVRFAPSPTGLLHVGNARVALLNRLFAKAHGGSFILRLDDTDLERSRPEFAEAILD
DLRWLGLDWDRLERQSARLDAYAAAAERLKVSGRVYACYETPDELELRRKVQLGRGLPPV
YDRAALKLAPDEIARLEAEGRRPHWRFKLELEDVRWDDCVRGPSHYHGGNLSDPVLIRGD
GSFLYTLPSVVDDIEFGVTHIIRGEDHVTNTAPQIQLFQALGAVPPAFAHLPLLTGATGE
GLSKRLGSGSLKDLRATGIHPMALNSLLAKLGSSDAIDIRHTLAELEAEFAWDKFGRGTP
KFDSAELERLDARLMHTASFAEVRDRLGIDGADEEFWLAVRPNLNHLAEAEAWWAICRQD
LTPVIEDGEFTRAAAALLPDGAWDHATWGAWTETVKQATGRKGKALFHPLRLALTGRENG
PELKTLLPLIGHDRARARLMGEIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory