SitesBLAST
Comparing WP_011383653.1 NCBI__GCF_000009985.1:WP_011383653.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6czaA The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to phosphate (see paper)
25% identity, 44% coverage: 14:418/922 of query aligns to 15:357/814 of 6czaA
- active site: R58 (≠ K61), C153 (≠ S160), A154 (≠ G161), R334 (≠ D395)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C23), T25 (≠ V24), R58 (≠ K61), H149 (≠ F156), V152 (≠ G159), C153 (≠ S160), G185 (= G197), A190 (= A202), S191 (= S203), N192 (≠ S204), D215 (≠ E226), P216 (= P227), R217 (≠ H228), P233 (= P244), D236 (= D247), S333 (≠ I394), R334 (≠ D395), R334 (≠ D395), G335 (= G396)
- binding phosphate ion: Y126 (≠ A134), S150 (≠ G157), K158 (= K165)
- binding iron/sulfur cluster: C21 (= C20), G23 (≠ Q22), C24 (= C23), S26 (≠ A25), W27 (≠ G26), C28 (≠ P27), K30 (≠ M30), C56 (= C59), R58 (≠ K61), S196 (≠ G208)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 681, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz9A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to arsenite (see paper)
25% identity, 44% coverage: 14:418/922 of query aligns to 15:357/814 of 6cz9A
- active site: R58 (≠ K61), C153 (≠ S160), A154 (≠ G161), R334 (≠ D395)
- binding arsenite: R125 (≠ G133), Y126 (≠ A134), H149 (≠ F156), C153 (≠ S160), Y170 (≠ H178)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C23), T25 (≠ V24), R58 (≠ K61), H149 (≠ F156), V152 (≠ G159), C153 (≠ S160), G185 (= G197), A190 (= A202), S191 (= S203), N192 (≠ S204), D215 (≠ E226), P216 (= P227), R217 (≠ H228), P233 (= P244), D236 (= D247), S333 (≠ I394), R334 (≠ D395), R334 (≠ D395), G335 (= G396)
- binding iron/sulfur cluster: C21 (= C20), G23 (≠ Q22), C24 (= C23), S26 (≠ A25), W27 (≠ G26), C28 (≠ P27), K30 (≠ M30), C56 (= C59), R58 (≠ K61), S196 (≠ G208)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 682, 684, 684, 685, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz8A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to arsenate (see paper)
25% identity, 44% coverage: 14:418/922 of query aligns to 15:357/814 of 6cz8A
- active site: R58 (≠ K61), C153 (≠ S160), A154 (≠ G161), R334 (≠ D395)
- binding arsenate: R125 (≠ G133), Y126 (≠ A134), H149 (≠ F156), C153 (≠ S160), Y170 (≠ H178)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C23), R58 (≠ K61), H149 (≠ F156), V152 (≠ G159), C153 (≠ S160), G185 (= G197), A190 (= A202), S191 (= S203), N192 (≠ S204), D215 (≠ E226), P216 (= P227), R217 (≠ H228), P233 (= P244), D236 (= D247), S333 (≠ I394), R334 (≠ D395), R334 (≠ D395), G335 (= G396)
- binding oxygen atom: R125 (≠ G133), H149 (≠ F156)
- binding iron/sulfur cluster: C21 (= C20), G23 (≠ Q22), C24 (= C23), S26 (≠ A25), W27 (≠ G26), C28 (≠ P27), K30 (≠ M30), C56 (= C59), R58 (≠ K61), S196 (≠ G208)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz7A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
25% identity, 44% coverage: 14:418/922 of query aligns to 15:357/814 of 6cz7A
- active site: R58 (≠ K61), C153 (≠ S160), A154 (≠ G161), R334 (≠ D395)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C23), T25 (≠ V24), R58 (≠ K61), H149 (≠ F156), V152 (≠ G159), C153 (≠ S160), G185 (= G197), A190 (= A202), S191 (= S203), N192 (≠ S204), D215 (≠ E226), P216 (= P227), R217 (≠ H228), P233 (= P244), D236 (= D247), S333 (≠ I394), R334 (≠ D395), R334 (≠ D395), G335 (= G396)
- binding iron/sulfur cluster: C21 (= C20), G23 (≠ Q22), C24 (= C23), S26 (≠ A25), W27 (≠ G26), C28 (≠ P27), K30 (≠ M30), C56 (= C59), R58 (≠ K61), V195 (≠ C207), S196 (≠ G208)
Sites not aligning to the query:
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 681, 682, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
Q7WTU0 Arsenate respiratory reductase molybdopterin-containing subunit ArrA; Arsenate respiratory reductase large subunit; ARR large subunit; EC 1.20.99.1 from Shewanella sp. (strain ANA-3) (see paper)
25% identity, 44% coverage: 14:418/922 of query aligns to 55:397/854 of Q7WTU0
- C61 (= C20) binding
- C64 (= C23) binding
- C68 (≠ P27) binding
- C96 (= C59) binding
- R165 (≠ G133) binding
- Y166 (≠ A134) binding
- H189 (≠ F156) binding
- S190 (≠ G157) binding
- C193 (≠ S160) binding
- K198 (= K165) binding
- Y210 (≠ H178) binding
A0A369NIV7 Dopamine dehydroxylase; EC 1.1.-.- from Eggerthella lenta (Eubacterium lentum) (see paper)
25% identity, 30% coverage: 10:285/922 of query aligns to 43:300/1017 of A0A369NIV7
Sites not aligning to the query:
- 506 Crucial for dopamine dehydroxylation activity
P18775 Dimethyl sulfoxide reductase DmsA; DMSO reductase; DMSOR; Me2SO reductase; EC 1.8.5.3 from Escherichia coli (strain K12) (see 4 papers)
21% identity, 66% coverage: 30:638/922 of query aligns to 73:583/814 of P18775
- C104 (= C59) mutation to S: No alteration of the growth, expression, or catalytic activities.
- R106 (≠ K61) mutation to S: Electron transfer from the 4Fe-4S clusters of DmsB to the Mo-bisMGD of DmsA is blocked. Little effect on the coordination sphere of the molybdenum and only minor effects on its redox chemistry.
Sites not aligning to the query:
- 1:45 signal peptide, Tat-type signal
- 17 R→S: Not targeted to the membrane, does not support anaerobic growth.
- 57 K→D: No alteration of the growth, expression, or catalytic activities.
- 67 C→S: Electron transfer from the 4Fe-4S clusters of DmsB to the Mo-bisMGD of DmsA is blocked. Little effect on the coordination sphere of the molybdenum and only minor effects on its redox chemistry.
- 71 C→S: Cannot support growth.
2ivfA Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
26% identity, 35% coverage: 59:378/922 of query aligns to 63:367/912 of 2ivfA
- active site: K65 (= K61), P127 (≠ Q122), D156 (= D155), I157 (≠ F156)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: H128 (≠ G123), H130 (≠ P125), A131 (≠ K126), I157 (≠ F156), D159 (≠ G159)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D159 (≠ G159), C190 (≠ T198), S191 (≠ N199), N192 (≠ T200), Y195 (≠ S203), T196 (≠ S204), I217 (≠ V225), P219 (= P227), D220 (≠ H228), N222 (≠ S230), G237 (≠ K245), D239 (= D247)
- binding iron/sulfur cluster: C63 (= C59), G66 (≠ A62)
Sites not aligning to the query:
- active site: 430
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 386, 543, 544, 545, 548, 549, 551, 571, 572, 573, 574, 588, 590, 591, 594, 623, 785, 791, 792, 856, 868, 869, 903
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 21, 23, 381, 382, 383, 783, 784, 785, 786, 789, 790, 791
- binding iron/sulfur cluster: 18, 22, 26, 28, 30, 62
2vpwA Polysulfide reductase with bound menaquinone (see paper)
28% identity, 23% coverage: 54:261/922 of query aligns to 45:242/734 of 2vpwA
- active site: R52 (≠ K61), H116 (≠ A134), D120 (≠ T138), K138 (≠ G161), C144 (≠ Y167), T145 (≠ H168)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R52 (≠ K61), H116 (≠ A134), L143 (≠ C166), C144 (≠ Y167), G178 (= G197), H179 (≠ T198), H180 (≠ N199), D184 (≠ S203), T185 (≠ S204), H186 (≠ G205), V206 (= V225), D207 (≠ E226), P208 (= P227), R209 (≠ H228), D228 (= D247)
- binding iron/sulfur cluster: L49 (≠ V58), C50 (= C59), R52 (≠ K61), G53 (≠ A62), N187 (≠ V206)
Sites not aligning to the query:
- active site: 303, 335, 340, 341, 351
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 302, 303, 304, 307, 308, 410, 411, 412, 415, 416, 436, 437, 441, 453, 459, 593, 594, 596, 596, 600, 601, 602, 602, 603, 604, 668, 687, 688, 706
- binding iron/sulfur cluster: 15, 17, 18, 20, 22
7l5sA Crystal structure of haemophilus influenzae mtsz at ph 5.5 (see paper)
21% identity, 56% coverage: 347:859/922 of query aligns to 267:700/771 of 7l5sA
- active site: W319 (= W416), Y355 (≠ I446), H356 (≠ R447), Y357 (≠ I448)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: W319 (= W416), G320 (= G417), M321 (vs. gap), R323 (vs. gap), R323 (vs. gap), Q324 (vs. gap), H356 (≠ R447), G422 (vs. gap), G423 (vs. gap), N424 (= N537), H428 (≠ S541), Q430 (≠ W543), N448 (≠ F561), E449 (≠ A562), V450 (≠ H563), A465 (≠ D578), R471 (≠ G584), D501 (≠ F621), T633 (= T790), P634 (≠ A791), H635 (≠ R792), H635 (≠ R792), P636 (≠ S793), R639 (≠ Y796), L640 (≠ A797), H641 (≠ W798), H641 (≠ W798), S642 (≠ G799), Q643 (≠ S800)
Sites not aligning to the query:
- active site: 38, 113, 142, 150, 151
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 111, 112, 113, 113, 114, 115, 122, 143, 144, 144, 182, 187, 188, 191, 217, 218, 219, 220, 240, 707, 728, 745
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
26% identity, 26% coverage: 55:291/922 of query aligns to 257:509/913 of 7vw6A
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K61), K339 (≠ M141), C364 (= C166), C368 (≠ E170), G402 (= G197), N404 (= N199), N408 (≠ S203), D431 (≠ E226), P432 (= P227), R433 (≠ H228), F447 (≠ I242), G450 (≠ K245), D452 (= D247)
- binding iron/sulfur cluster: C261 (= C59), K263 (= K61), G264 (≠ A62), V411 (= V206)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 32, 34, 35, 45, 47, 48, 50, 64
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 525, 526, 527, 530, 531, 563, 564, 630, 632, 636, 656, 657, 658, 805, 807, 807, 808, 809, 811, 812, 813, 813, 814, 817, 879, 887, 903, 904
- binding iron/sulfur cluster: 145, 146, 147, 148, 149, 151, 155, 161, 163, 164, 175, 188, 189, 190, 191, 192, 194, 198, 199, 200, 202, 203, 227, 230, 234
2e7zA Acetylene hydratase from pelobacter acetylenicus (see paper)
23% identity, 25% coverage: 49:274/922 of query aligns to 31:242/727 of 2e7zA
- active site: K45 (= K61), T108 (≠ G132), I110 (≠ A134), W131 (vs. gap), C138 (≠ G157), I139 (≠ F158)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K45 (= K61), T108 (≠ G132), N111 (≠ G135), A134 (vs. gap), M137 (≠ F156), C138 (≠ G157), G168 (= G197), K169 (≠ T198), N170 (= N199), N175 (≠ S204), W176 (≠ G205), L196 (≠ V225), D197 (≠ E226), P198 (= P227), R199 (≠ H228), Y215 (≠ P244), G216 (≠ K245), D218 (= D247)
- binding iron/sulfur cluster: C43 (= C59), K45 (= K61), S46 (≠ A62), W176 (≠ G205), V177 (= V206)
Sites not aligning to the query:
- active site: 292, 335, 336, 337
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 10, 292, 293, 296, 297, 413, 415, 419, 420, 439, 440, 441, 457, 462, 599, 602, 603, 603, 604, 605, 607, 608, 609, 609, 610, 611, 673, 696, 716, 717
- binding iron/sulfur cluster: 6, 8, 9, 11, 12, 13
Q71EW5 Acetylene hydratase; Ahy; EC 4.2.1.112 from Syntrophotalea acetylenica (Pelobacter acetylenicus) (see 3 papers)
23% identity, 25% coverage: 49:274/922 of query aligns to 34:245/730 of Q71EW5
- C46 (= C59) binding
- K48 (= K61) binding ; mutation to A: Does not affect catalytic activity.
- TEIN 111:114 (≠ GGAG 132:135) binding
- C141 (≠ G157) binding
- I142 (≠ F158) mutation to A: Strongly impairs catalytic activity.
- KN 172:173 (≠ TN 198:199) binding
- HNW 177:179 (≠ SSG 203:205) binding
- LDPR 199:202 (≠ VEPH 225:228) binding
- YGTD 218:221 (≠ PKTD 244:247) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 binding
- 12 binding
- 13 D→A: Almost abolishes catalytic activity.; D→E: Does not affect catalytic activity.
- 16 binding
- 296 binding
- 300 binding
- 416:418 binding
- 422:423 binding
- 442:444 binding
- 460 binding
- 465 binding
- 602:613 binding
- 606 binding
- 676 binding
- 699 binding
- 720 binding
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
24% identity, 28% coverage: 14:274/922 of query aligns to 2:241/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
22% identity, 27% coverage: 16:266/922 of query aligns to 7:239/549 of 7bkbD
5ch7A Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
24% identity, 34% coverage: 70:382/922 of query aligns to 80:405/894 of 5ch7A
- active site: P133 (≠ K126), P135 (≠ A128), W162 (≠ A150), Y163 (≠ W151), D165 (≠ P153), P167 (≠ D155)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: Y163 (≠ W151), D165 (≠ P153)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D165 (≠ P153), G196 (= G197), N198 (= N199), Q201 (≠ S203), T202 (≠ S204), I223 (≠ V225), P225 (= P227), D226 (≠ H228), N228 (≠ S230), D245 (= D247)
- binding molybdenum atom: D165 (≠ P153)
Sites not aligning to the query:
- active site: 71, 452, 455
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 421, 532, 533, 534, 538, 559, 560, 561, 562, 564, 576, 579, 582, 610, 757, 759, 765, 766, 767, 830, 844, 876
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 416, 417, 418, 422, 453, 454, 756, 758, 759, 760, 763, 764, 765, 825, 877
- binding molybdenum atom: 454
- binding iron/sulfur cluster: 27, 31, 33, 35, 68, 69, 72
- binding sulfite ion: 799, 891, 893
- binding zinc ion: 76, 77
5chcA Crystal structure of the perchlorate reductase pcrab - substrate analog seo3 bound - from azospira suillum ps (see paper)
24% identity, 34% coverage: 70:382/922 of query aligns to 81:406/895 of 5chcA
- active site: P134 (≠ K126), P136 (≠ A128), W163 (≠ A150), Y164 (≠ W151), D166 (≠ P153), P168 (≠ D155)
- binding biselenite ion: F160 (= F147), Y164 (≠ W151), D166 (≠ P153)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: Y164 (≠ W151), D166 (≠ P153)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D166 (≠ P153), G197 (= G197), Q202 (≠ S203), T203 (≠ S204), I224 (≠ V225), P226 (= P227), D227 (≠ H228), N229 (≠ S230), D246 (= D247)
- binding molybdenum atom: D166 (≠ P153)
Sites not aligning to the query:
- active site: 72, 453, 456
- binding biselenite ion: 455
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 422, 533, 534, 535, 539, 560, 561, 563, 565, 580, 611, 758, 760, 766, 767, 768, 831, 845, 877
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 417, 418, 419, 423, 454, 455, 757, 759, 760, 761, 764, 765, 766, 826, 878
- binding molybdenum atom: 455
- binding iron/sulfur cluster: 28, 32, 34, 36, 69, 70, 73
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
31% identity, 14% coverage: 13:141/922 of query aligns to 1:119/697 of 2iv2X
- active site: C11 (= C23), L41 (≠ V58), C42 (= C59), K44 (= K61), S108 (= S130)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (≠ G132), G111 (= G133), T112 (≠ A134)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K61)
- binding iron/sulfur cluster: C8 (= C20), C11 (= C23), S13 (≠ A25), C15 (≠ P27), L41 (≠ V58), C42 (= C59), K44 (= K61), G45 (≠ A62)
Sites not aligning to the query:
- active site: 140, 141, 180, 297, 333, 334, 335
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: 137, 335, 402, 403, 404, 408, 410, 428, 429, 430, 445, 478, 588, 660
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 173, 174, 175, 176, 179, 180, 202, 203, 204, 223, 296, 297, 302, 334, 581, 582, 583, 585, 586, 587, 661
- binding iron/sulfur cluster: 183
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
31% identity, 14% coverage: 13:141/922 of query aligns to 1:119/715 of 1fdiA
- active site: C11 (= C23), L41 (≠ V58), C42 (= C59), K44 (= K61), S108 (= S130), R110 (≠ G132)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K61), R110 (≠ G132), G111 (= G133)
- binding iron/sulfur cluster: C8 (= C20), Y10 (≠ Q22), C11 (= C23), S13 (≠ A25), C15 (≠ P27), L41 (≠ V58), C42 (= C59), K44 (= K61)
Sites not aligning to the query:
- active site: 134, 140, 141, 180, 297, 333, 334, 335
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 139, 140, 173, 174, 175, 176, 179, 180, 201, 202, 203, 204, 218, 221, 223, 296, 297, 298, 302, 334, 335, 335, 402, 403, 408, 428, 429, 430, 445, 478, 579, 580, 581, 581, 582, 585, 586, 587, 588, 654, 662, 678, 679
- binding nitrite ion: 140, 141, 333, 334, 338
- binding iron/sulfur cluster: 182, 183
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 14% coverage: 13:141/922 of query aligns to 1:119/715 of P07658
- C8 (= C20) binding
- Y10 (≠ Q22) binding
- C11 (= C23) binding
- C15 (≠ P27) binding
- C42 (= C59) binding
- K44 (= K61) binding
Sites not aligning to the query:
- 140 modified: nonstandard, Selenocysteine
- 297 binding
- 301 binding
- 335 binding
- 445 binding
- 478 binding
- 588 binding
- 654 binding
- 655 binding
- 678 binding
- 679 binding
Query Sequence
>WP_011383653.1 NCBI__GCF_000009985.1:WP_011383653.1
MSAAPAGGGGKKVEKVQTYCYQCVAGPDLMTVKVVDGVATEIEPNFKAADTHPAEGKVCV
KAFGLIQKSYTPHRILTPMKRTNPKKGKDQDPGFVPISWDEAMGTIAERLNAIRAEGLLD
AQGYPKFAASFGGAGTPTQYMGSLTAFLSAWGPIDFGFGSGQGVKCYHSEHLYGEFWHRG
YVITPDTPRANYIISCGTNTEASSGVCGVYRHAEARARGAIRVQVEPHLSVTGACSAEWL
PIKPKTDAAFLMTLLNVLVFEAPRERLDLDFLRNTTSSPYLVGPDGWYLRDPETHKPLLW
DEKTGRAVPHDTPGAVPALEGRFTVPKAVTLGADEDRWEHTDVEGVTAFTKFIEHVKGYT
PAWGAKVCDVPEARIRKIANDFLDHACVGQTIEIDGQVMPYRPVAVVLGKTVNNGWGGAE
CCWARTMLAVLVGALEVPGGTVGTTIRINRPAANRLESFEGCLDGFMEYPFNPTDKDTWK
ANPIIRNAYKMLVPLVGNSSWSPALGPTQFSYMFLDEPQDQIPRATFPEFLLVYRTNPVI
SFWDTDRVASVVSRMPFVVCFAHTRDETNHFADILLPDATDLEGMQLIRIGGTKFQEQFW
KQQGFALRQPSVKPQGEARDFTDIATDLAVRTGLQEKYVAAINRGSHGVPLKGPNWDFSL
PVDKAPSLEEVWDASCRSASAELSDGAESQGLDWWKENGFRTIPFSETNWFLTPALKAKG
LRYELPYQERLTRIGRQLANRLKEAGITWWDHQLTEYRPLMEWHDFPGYWEQSVVEHGGK
VADFPFWVVTARSMQYAWGSNMHIPLMREVSGHIKGHDGVVMNPEAARKVGVKEGERIVV
TAPTGKSVAGRVVLSQGIRPDTILMMSQFDHWATPIAKDFDVPSMNRLTAMTMQLTDATG
SAADLSRVAIRKARADEQGRRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory