SitesBLAST
Comparing WP_011383705.1 NCBI__GCF_000009985.1:WP_011383705.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
44% identity, 98% coverage: 2:385/390 of query aligns to 1:390/391 of 2gqnA
- active site: R54 (= R54), Y107 (= Y107), D181 (= D179), K206 (= K203)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), E108 (≠ F108), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
44% identity, 98% coverage: 2:385/390 of query aligns to 1:390/391 of 2fq6A
- active site: R54 (= R54), Y107 (= Y107), D181 (= D179), K206 (= K203)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), P109 (= P109), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
44% identity, 98% coverage: 2:385/390 of query aligns to 1:390/391 of 1cl2A
- active site: R54 (= R54), Y107 (= Y107), D181 (= D179), K206 (= K203)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
44% identity, 98% coverage: 2:385/390 of query aligns to 5:394/395 of P06721
- K210 (= K203) modified: N6-(pyridoxal phosphate)lysine
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
44% identity, 98% coverage: 2:385/390 of query aligns to 2:391/392 of 1cl1B
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
44% identity, 98% coverage: 2:385/390 of query aligns to 1:390/391 of 4itxA
- active site: R54 (= R54), Y107 (= Y107), D181 (= D179), K206 (= K203)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
45% identity, 98% coverage: 5:385/390 of query aligns to 4:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), T205 (= T202), K206 (= K203), M215 (= M212), W336 (= W333)
- binding serine: Y107 (= Y107), K206 (= K203), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
45% identity, 98% coverage: 5:385/390 of query aligns to 4:390/391 of 8u98A
- binding glycine: Y107 (= Y107), K206 (= K203), Y334 (≠ F331), S335 (= S332), W336 (= W333), R368 (= R363)
- binding pyridoxal-5'-phosphate: Y52 (= Y52), R54 (= R54), C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), W336 (= W333)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
45% identity, 98% coverage: 5:385/390 of query aligns to 4:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), W336 (= W333)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S81), G82 (= G82), A83 (≠ L83), Y107 (= Y107), D181 (= D179), A203 (= A200), T205 (= T202), K206 (= K203), M215 (= M212), S335 (= S332), W336 (= W333), R368 (= R363)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
45% identity, 98% coverage: 5:385/390 of query aligns to 5:391/392 of 8sabA
- binding lysine: N9 (≠ H9), R12 (= R12), R13 (≠ K13), K14 (≠ P14), T17 (≠ F17), L330 (≠ H326), E341 (= E337)
- binding pyridoxal-5'-phosphate: C82 (≠ S81), G83 (= G82), A84 (≠ L83), Y108 (= Y107), D182 (= D179), A204 (= A200), T206 (= T202), K207 (= K203), M216 (= M212), W337 (= W333)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S81), G83 (= G82), A84 (≠ L83), Y108 (= Y107), D182 (= D179), A204 (= A200), T206 (= T202), K207 (= K203), M216 (= M212), Y335 (≠ F331), S336 (= S332), W337 (= W333), R369 (= R363)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
45% identity, 98% coverage: 5:385/390 of query aligns to 11:397/398 of 8sadA
- binding magnesium ion: A359 (vs. gap), R362 (= R350), A365 (≠ T353)
- binding pyridoxal-5'-phosphate: C88 (≠ S81), G89 (= G82), A90 (≠ L83), Y114 (= Y107), D188 (= D179), A210 (= A200), T212 (= T202), K213 (= K203), M222 (= M212), W343 (= W333)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
34% identity, 99% coverage: 1:385/390 of query aligns to 1:373/373 of 4l0oH
- active site: R40 (= R54), Y92 (= Y107), D164 (= D179), K189 (= K203)
- binding pyridoxal-5'-phosphate: Y38 (= Y52), R40 (= R54), S67 (= S81), G68 (= G82), L69 (= L83), Y92 (= Y107), D164 (= D179), S186 (≠ A200), T188 (= T202), K189 (= K203)
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
33% identity, 98% coverage: 1:382/390 of query aligns to 1:376/377 of 7d7oB
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
36% identity, 97% coverage: 4:382/390 of query aligns to 5:380/384 of 4iyoD
- active site: R47 (= R54), Y99 (= Y107), D172 (= D179), K197 (= K203)
- binding serine: Y45 (= Y52), T48 (≠ F55), Y99 (= Y107), Y99 (= Y107), R104 (≠ K112), K197 (= K203), N227 (≠ A232), E325 (≠ F331), S326 (= S332), T341 (≠ G345), R361 (= R363)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
36% identity, 97% coverage: 4:382/390 of query aligns to 5:380/381 of 4iyoB
- active site: R47 (= R54), Y99 (= Y107), D172 (= D179), K197 (= K203)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y52), R47 (= R54)
- binding amino-acrylate: Y99 (= Y107), K197 (= K203), S326 (= S332), T341 (≠ G345), R361 (= R363)
- binding pyruvic acid: Q221 (= Q226), F224 (≠ T229)
- binding serine: Y45 (= Y52), T48 (≠ F55), Y99 (= Y107), R104 (≠ K112), N227 (≠ A232), E325 (≠ F331)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
36% identity, 97% coverage: 4:382/390 of query aligns to 5:380/381 of 4iy7B
- active site: R47 (= R54), Y99 (= Y107), D172 (= D179), K197 (= K203)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y52), R47 (= R54)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G82), M76 (≠ L83), Y99 (= Y107), E143 (= E150), N147 (≠ S154), D172 (= D179), S194 (≠ A200), K197 (= K203), S326 (= S332), L327 (≠ W333), T341 (≠ G345), R361 (= R363)
- binding pyruvic acid: Q221 (= Q226), F224 (≠ T229)
- binding serine: Y45 (= Y52), T48 (≠ F55), Y99 (= Y107), R104 (≠ K112), N227 (≠ A232), E325 (≠ F331)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
36% identity, 97% coverage: 4:382/390 of query aligns to 5:380/381 of 4iy7A
- active site: R47 (= R54), Y99 (= Y107), D172 (= D179), K197 (= K203)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G82), M76 (≠ L83), Y99 (= Y107), E143 (= E150), N147 (≠ S154), D172 (= D179), S194 (≠ A200), K197 (= K203), S326 (= S332), L327 (≠ W333), T341 (≠ G345), R361 (= R363)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y52), R47 (= R54)
- binding serine: Y45 (= Y52), T48 (≠ F55), Y99 (= Y107), R104 (≠ K112), N227 (≠ A232), E325 (≠ F331)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
36% identity, 97% coverage: 4:382/390 of query aligns to 5:380/381 of 4ixzA
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
33% identity, 98% coverage: 4:384/390 of query aligns to 9:394/396 of 6egrA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
33% identity, 98% coverage: 4:384/390 of query aligns to 9:394/396 of 4omaA
- active site: R59 (= R54), Y112 (= Y107), D184 (= D179), K209 (= K203)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G82), I88 (≠ L83), Y112 (= Y107), D184 (= D179), S206 (≠ A200), T208 (= T202), K209 (= K203), V337 (≠ F331), S338 (= S332), R373 (= R363)
Query Sequence
>WP_011383705.1 NCBI__GCF_000009985.1:WP_011383705.1
MKKSTRILHAGRKPEAFHGAVNPPVYHASTILHPSVAAMEKSGKTPFEGVRYGRFGTPTT
FALEEAVAELEGGHRTVATSSGLAAITGALLAFLKAGDHLLMVDTTYFPTRKFCDSVLGG
LGIETTYYDPLVGAGITALMRPNTRVVFTESPGSLTFEVQDIPAIAEAAHAGGAVVMMDN
TWGVLHFQPFTKGIDISIQAATKYIVGHADAMLGTITAATPELWLQVKTSLAAFGASPGT
EEMYLGLRGLRTLPVRLRQHAESALRLTRWLEARPEVDRVLYPPLASDPGHELWKRDFTG
GCGLFGVILKPASKAAVDAMLDGYSHFKLGFSWGGFESLVIPTSGHSIIRTATPWTPVGP
SLRFHAGLEDADDLEEDLERGFERLACAVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory