Comparing WP_011383723.1 AMB_RS06675 membrane protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5uhsA Structure of a semisweet d57a mutant (see paper)
49% identity, 82% coverage: 8:84/94 of query aligns to 3:79/81 of 5uhsA
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
46% identity, 89% coverage: 8:91/94 of query aligns to 3:85/85 of B0SR19
P0DMV3 Sugar transporter SemiSWEET from Escherichia coli (strain UMEA 3162-1) (see paper)
43% identity, 71% coverage: 24:90/94 of query aligns to 21:87/89 of P0DMV3
Sites not aligning to the query:
>WP_011383723.1 AMB_RS06675 membrane protein
MDWLSPIDLLGAAAGVLTTISFVPQVVKTLRTRQTRDISLAMWVCFITGVSLWTVYGLLL
GAWPIVASNLPTLGLAGTILVIKLRNMGKETGGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory