Comparing WP_011383782.1 NCBI__GCF_000009985.1:WP_011383782.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
57% identity, 97% coverage: 10:259/259 of query aligns to 9:257/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
40% identity, 94% coverage: 12:254/259 of query aligns to 3:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 95% coverage: 12:258/259 of query aligns to 4:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 95% coverage: 12:258/259 of query aligns to 4:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 95% coverage: 12:258/259 of query aligns to 4:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 95% coverage: 12:258/259 of query aligns to 4:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 91% coverage: 20:255/259 of query aligns to 10:237/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 91% coverage: 20:254/259 of query aligns to 12:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 91% coverage: 20:254/259 of query aligns to 13:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 91% coverage: 20:254/259 of query aligns to 13:242/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 91% coverage: 20:254/259 of query aligns to 13:242/344 of 6cvlD
Sites not aligning to the query:
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
36% identity, 88% coverage: 18:245/259 of query aligns to 343:569/571 of 4ayxA
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
37% identity, 95% coverage: 10:256/259 of query aligns to 1:251/258 of 1b0uA
Q9NRK6 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2 from Homo sapiens (Human) (see 5 papers)
36% identity, 88% coverage: 18:245/259 of query aligns to 496:722/738 of Q9NRK6
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 95% coverage: 10:256/259 of query aligns to 5:255/258 of P02915
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
36% identity, 88% coverage: 18:246/259 of query aligns to 461:688/715 of Q9JI39
Sites not aligning to the query:
7y48B Cryo-em structure of biliverdin-bound mitochondrial abc transporter abcb10 from biortus
36% identity, 88% coverage: 18:245/259 of query aligns to 342:565/567 of 7y48B
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 90% coverage: 22:254/259 of query aligns to 37:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 90% coverage: 22:254/259 of query aligns to 37:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
34% identity, 85% coverage: 27:245/259 of query aligns to 42:254/260 of 7ahdC
Sites not aligning to the query:
>WP_011383782.1 NCBI__GCF_000009985.1:WP_011383782.1
MNQFIPRGTSKISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCINRM
NDMVDGAKVTGSLTLDGSDVYDRSLDVVQLRARVGMVFQKPNPFPKSIYDNVAYGPRIHG
LARDQAELDEIVMNSLEKAGLLAEVESRLSESGTGLSGGQQQRLCIARAIAVAPEVILMD
EPCSALDPIATAKVEELIDELRDNYTIVIVTHSMQQAARVSQRTAFFHLGKLIEVGGTEE
IFTNPKEPLTQGYITGRFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory