SitesBLAST
Comparing WP_011383786.1 AMB_RS06965 PLP-dependent aminotransferase family protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
32% identity, 84% coverage: 77:536/547 of query aligns to 5:449/458 of 7zlaB
- binding : P9 (= P81), L10 (= L82), Y11 (≠ H83), S35 (= S107), K36 (≠ S108), R37 (= R109), K38 (≠ G110), Q47 (≠ R119), Q47 (≠ R119), N48 (= N120), T49 (= T121), R68 (= R148)
Sites not aligning to the query:
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
31% identity, 84% coverage: 77:536/547 of query aligns to 2:426/435 of 7zn5B
- binding : P6 (= P81), S32 (= S107), R34 (= R109), K35 (≠ G110), S43 (≠ A118), Q44 (≠ R119), N45 (= N120), E48 (≠ L123), R65 (= R169), K66 (≠ T170), R341 (≠ G452)
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
33% identity, 65% coverage: 189:543/547 of query aligns to 6:357/360 of 5t4kA
- binding (4S)-5-fluoro-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: H8 (≠ P191), M9 (≠ G192), T75 (≠ S258), Y99 (= Y283), F144 (= F330), D173 (= D358), Y175 (= Y360), T203 (= T388), S205 (= S390), R213 (= R398), R324 (≠ F510)
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
33% identity, 65% coverage: 189:543/547 of query aligns to 6:357/360 of 5t4jB
- binding gamma-amino-butanoic acid: H8 (≠ P191), M9 (≠ G192), Y99 (= Y283), Y175 (= Y360), R324 (≠ F510)
- binding pyridoxal-5'-phosphate: T75 (≠ S258), Y99 (= Y283), F144 (= F330), D173 (= D358), Y175 (= Y360), T203 (= T388), S205 (= S390), R213 (= R398), S215 (≠ G400)
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
33% identity, 65% coverage: 189:543/547 of query aligns to 5:356/358 of 6uxzB
- binding (4S)-4-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-5-phenoxypentanoic acid: H7 (≠ P191), M8 (≠ G192), G73 (= G257), T74 (≠ S258), Y98 (= Y283), R100 (≠ G285), F143 (= F330), D172 (= D358), Y174 (= Y360), T202 (= T388), S204 (= S390), K205 (= K391), P209 (= P395), R212 (= R398), R323 (≠ F510)
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
33% identity, 65% coverage: 189:543/547 of query aligns to 5:361/365 of 5x03B
7pq9AAA PLP-dependent aminotransferase family protein (see paper)
31% identity, 64% coverage: 189:536/547 of query aligns to 7:353/367 of 7pq9AAA
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
29% identity, 65% coverage: 189:543/547 of query aligns to 37:398/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G192), L41 (≠ V193)
- binding 2-oxoglutaric acid: D213 (= D359), P214 (≠ Y360), Y215 (≠ D361), G216 (≠ S362), E217 (≠ D363), G241 (= G387), T242 (= T388), I246 (≠ S392)
- binding (2E)-pent-2-enedioic acid: G40 (= G192), Y130 (= Y283), N184 (≠ F330), R376 (≠ V521)
- binding glutamic acid: L131 (≠ G284), V360 (≠ S506), A364 (vs. gap), R369 (= R512)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G257), S105 (= S258), Q106 (= Q259), Y130 (= Y283), N184 (≠ F330), D212 (= D358), P214 (≠ Y360), Y215 (≠ D361), T242 (= T388), S244 (= S390), K245 (= K391), R252 (= R398)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
29% identity, 65% coverage: 189:543/547 of query aligns to 37:398/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ G284), Q135 (≠ G288), A364 (vs. gap), R369 (= R512)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G192), Y130 (= Y283), L131 (≠ G284), A132 (≠ G285), N184 (≠ F330), R376 (≠ V521)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G257), S105 (= S258), Q106 (= Q259), Y130 (= Y283), V179 (≠ T325), N184 (≠ F330), D212 (= D358), P214 (≠ Y360), Y215 (≠ D361), T242 (= T388), S244 (= S390), K245 (= K391), R252 (= R398)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
29% identity, 65% coverage: 189:543/547 of query aligns to 37:398/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (≠ G222), Y130 (= Y283), L275 (≠ M421)
- binding pyridoxal-5'-phosphate: G104 (= G257), S105 (= S258), Q106 (= Q259), Y130 (= Y283), V179 (≠ T325), N184 (≠ F330), D212 (= D358), P214 (≠ Y360), Y215 (≠ D361), T242 (= T388), S244 (= S390), K245 (= K391), R252 (= R398)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
29% identity, 65% coverage: 189:543/547 of query aligns to 37:398/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G257), S105 (= S258), Q106 (= Q259), Y130 (= Y283), V179 (≠ T325), N184 (≠ F330), D212 (= D358), P214 (≠ Y360), Y215 (≠ D361), T242 (= T388), S244 (= S390), K245 (= K391), R252 (= R398)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
29% identity, 58% coverage: 227:543/547 of query aligns to 72:396/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G257), S103 (= S258), Q104 (= Q259), Y128 (= Y283), V177 (≠ T325), N182 (≠ F330), D210 (= D358), P212 (≠ Y360), Y213 (≠ D361), T240 (= T388), S242 (= S390), K243 (= K391), R250 (= R398)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
28% identity, 57% coverage: 189:501/547 of query aligns to 39:357/405 of 2zc0A
- active site: Y132 (= Y283), D214 (= D358), A216 (≠ Y360), S246 (= S390)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G257), G107 (≠ S258), T108 (≠ Q259), Y132 (= Y283), N186 (≠ F330), D214 (= D358), A216 (≠ Y360), Y217 (≠ D361), T244 (= T388), S246 (= S390), K247 (= K391), R254 (= R398)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
31% identity, 66% coverage: 189:547/547 of query aligns to 37:394/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ P191), G40 (= G192), G99 (= G257), S100 (= S258), Q101 (= Q259), Y125 (= Y283), N174 (≠ F330), D202 (= D358), Y205 (≠ D361), S235 (≠ T388), S237 (= S390), K238 (= K391), R245 (= R398), R368 (≠ V521)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
31% identity, 66% coverage: 189:547/547 of query aligns to 37:394/397 of Q72LL6
- G40 (= G192) binding
- Y70 (≠ G222) binding
- N174 (≠ F330) binding ; binding
- R245 (= R398) binding
- R368 (≠ V521) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
31% identity, 66% coverage: 189:547/547 of query aligns to 29:386/389 of 2z1yA
- binding leucine: G32 (= G192), Y117 (= Y283), R360 (≠ V521)
- binding pyridoxal-5'-phosphate: G91 (= G257), S92 (= S258), Q93 (= Q259), Y117 (= Y283), N166 (≠ F330), D194 (= D358), Y197 (≠ D361), S227 (≠ T388), S229 (= S390), K230 (= K391), R237 (= R398)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
31% identity, 66% coverage: 189:547/547 of query aligns to 33:390/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ P191), G36 (= G192), G95 (= G257), S96 (= S258), Q97 (= Q259), Y121 (= Y283), N170 (≠ F330), D198 (= D358), Y201 (≠ D361), S231 (≠ T388), S233 (= S390), K234 (= K391), R241 (= R398), R364 (≠ V521)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
31% identity, 66% coverage: 189:547/547 of query aligns to 33:390/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G257), S96 (= S258), Q97 (= Q259), Y121 (= Y283), N170 (≠ F330), D198 (= D358), A200 (≠ Y360), Y201 (≠ D361), S231 (≠ T388), S233 (= S390), K234 (= K391), R241 (= R398)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
25% identity, 65% coverage: 189:544/547 of query aligns to 43:411/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G257), S113 (= S258), Q114 (= Q259), Y138 (= Y283), N194 (≠ F330), D222 (= D358), P224 (≠ Y360), Y225 (≠ D361), T252 (= T388), S254 (= S390), K255 (= K391), R262 (= R398)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
32% identity, 54% coverage: 247:542/547 of query aligns to 82:386/388 of 8tn3A
Query Sequence
>WP_011383786.1 AMB_RS06965 PLP-dependent aminotransferase family protein
MHDRASSRMAAMASKSWLPRWGRWRKVVRSVLADMVALLSYSDWAESGSLKRSTSFIIME
PLPESAMPPPLPLALPDLDAPLHRRLYLALRDSILDGRLAEGAALPSSRGLAAQLGVARN
TVLAAYDLLAAEGFTEAHRGSATRVAARHPLVGAAPAGEEAPPSPLPPRTRAWGAAPPMI
LVRDPFRPFAPGVPDLAAFPHAEWRRVLGRLWRRPPLELMGGIDPLGHAPLRHAIAEHLG
RSRAVRCDPAQVMIMGGSQQALDLVARVLLEPGEAVLVEDPCYGGLTGVLRAAGAQVQAV
AVDGQGFDPELAERQCPSARLTFVTPSHQFPTGATMPLSRRLALIHWAERVGGWVIEDDY
DSDFHHAGSPTASLQGLDRGGRTLYLGTFSKSMFPGLRLGWLVVPPPLLPAFVAARRIAD
MAPAGLTQAAMAAFMTEGHFGAHLRRMRTLYGQRRRALLDAAPRILGPNLPVTAGEAGLH
AILWLPAGCDDFQAAEAARARGLAPSPLSFHRVTKGCPGLVLGYGNLAGSSLEEALQRLR
EAIITLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory