Comparing WP_011383886.1 NCBI__GCF_000009985.1:WP_011383886.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 5:247/261 of query aligns to 3:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 5:247/261 of query aligns to 3:253/254 of 1g6hA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 93% coverage: 6:247/261 of query aligns to 2:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 93% coverage: 6:247/261 of query aligns to 2:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 93% coverage: 6:247/261 of query aligns to 2:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 93% coverage: 6:247/261 of query aligns to 3:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 92% coverage: 6:246/261 of query aligns to 2:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 92% coverage: 6:246/261 of query aligns to 2:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 92% coverage: 6:245/261 of query aligns to 2:233/233 of 6b8bA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 91% coverage: 7:244/261 of query aligns to 3:232/241 of 4u00A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 92% coverage: 7:247/261 of query aligns to 3:235/240 of 6mjpA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 88% coverage: 7:236/261 of query aligns to 5:224/285 of 4yerA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 95% coverage: 5:252/261 of query aligns to 2:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 95% coverage: 5:252/261 of query aligns to 2:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 95% coverage: 5:252/261 of query aligns to 2:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 95% coverage: 5:252/261 of query aligns to 2:242/242 of 2oljA
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
31% identity, 90% coverage: 2:237/261 of query aligns to 1374:1592/1704 of P34358
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 88% coverage: 11:240/261 of query aligns to 22:240/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 85% coverage: 19:240/261 of query aligns to 18:233/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 85% coverage: 19:240/261 of query aligns to 19:234/344 of 3tuzC
Sites not aligning to the query:
>WP_011383886.1 NCBI__GCF_000009985.1:WP_011383886.1
MSQNQTLSVRGLSKNYGGVAAVTNVDFDLAPGEILALIGPNGAGKSTCFNMLNGQFPPTA
GSIKLFGEELVGKKPREIWRLGVGRTFQITATFGSMTVLENVQMALISFHNRLRALWPFA
GGLYQDEAFQLLELVGMEAQASRPCSVLAYGDLKRVELAVALANAPKLLLMDEPTAGMAP
KERIELMQLTADIVRERGISVLFTEHDMDVVFTHANRIMVLSRGHVVAEGKPQEVRANPE
VQATYLGTGAVYDDSKHKGAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory