SitesBLAST
Comparing WP_011384008.1 NCBI__GCF_000009985.1:WP_011384008.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5el0A Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase family) from brucella ovis in complex with a partially ordered NAD
47% identity, 97% coverage: 3:239/245 of query aligns to 1:223/223 of 5el0A
- active site: G13 (= G15), S142 (= S142), A152 (= A152), Y156 (= Y156), K160 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G11), S11 (= S13), S33 (≠ A35), R34 (= R36), V53 (≠ A55), D54 (= D56), L55 (= L57), G87 (= G87), I88 (≠ V88), A192 (≠ E192), L194 (≠ M210)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 4:243/244 of 6t62A
- active site: G16 (= G15), S138 (= S142), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), A36 (= A35), T37 (≠ R36), L58 (≠ A55), D59 (= D56), V60 (≠ L57), N86 (= N85), A87 (= A86), G88 (= G87), I89 (≠ V88), I136 (= I140), S137 (≠ T141), S138 (= S142), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), I184 (= I189), M188 (= M193)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 4:243/244 of 6wprA
- active site: G16 (= G15), S138 (= S142), Y151 (= Y156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), T37 (≠ R36), L58 (≠ A55), D59 (= D56), V60 (≠ L57), N86 (= N85), A87 (= A86), G88 (= G87), I89 (≠ V88), I136 (= I140), Y151 (= Y156), K155 (= K160), P181 (= P186)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 99% coverage: 3:244/245 of query aligns to 4:243/244 of 6t77A
- active site: G16 (= G15), S138 (= S142), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), T37 (≠ R36), L58 (≠ A55), N59 (≠ D56), V60 (≠ L57), A87 (= A86), G88 (= G87), I89 (≠ V88)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
32% identity, 98% coverage: 5:244/245 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G15), S138 (= S142), Q148 (≠ G153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (= R14), I13 (= I16), N31 (≠ T33), Y32 (≠ C34), A33 (= A35), G34 (≠ R36), S35 (≠ A37), A58 (= A55), N59 (≠ D56), V60 (≠ L57), N86 (= N85), A87 (= A86), T109 (≠ L114), S138 (= S142), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 4:243/244 of P0A2C9
- M125 (≠ L130) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ C224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ G225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
35% identity, 98% coverage: 3:243/245 of query aligns to 5:239/241 of 5t2uA
- active site: G17 (= G15), T135 (≠ S142), T145 (≠ G153), Y148 (= Y156), K152 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), G17 (= G15), R38 (= R36), D39 (vs. gap), R42 (≠ V39), D60 (= D56), L61 (= L57), N83 (= N85), A84 (= A86), Y87 (≠ S89), I133 (= I140), T135 (≠ S142), Y148 (= Y156), K152 (= K160), P178 (= P186), P180 (≠ E188), T181 (≠ I189), T183 (= T191), T185 (vs. gap), T186 (vs. gap)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 10:255/257 of 5fffA
- active site: K206 (≠ Y198)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ V100), H158 (≠ G153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), T20 (≠ S13), G22 (= G15), I23 (= I16), R43 (= R36), C67 (≠ A58), D68 (= D59), V69 (≠ P60), N96 (= N85), I146 (= I140), Y161 (= Y156), K165 (= K160), P191 (= P186), A193 (≠ E188), I194 (= I189), T196 (vs. gap), G198 (vs. gap), T199 (= T191)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 10:255/257 of 5ff9B
- active site: K206 (≠ Y198)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ V100), I155 (≠ H149), H158 (≠ G153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), T20 (≠ S13), K21 (≠ R14), I23 (= I16), S42 (≠ A35), R43 (= R36), C67 (≠ A58), D68 (= D59), V69 (≠ P60), N96 (= N85), I146 (= I140), S148 (= S142), Y161 (= Y156), K165 (= K160), P191 (= P186), A193 (≠ E188), I194 (= I189), T196 (vs. gap), G198 (vs. gap), T199 (= T191)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 10:255/257 of A0A1A9TAK5
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
32% identity, 100% coverage: 1:244/245 of query aligns to 1:246/246 of 3osuA
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 97% coverage: 5:241/245 of query aligns to 6:235/240 of 2d1yA
- active site: G16 (= G15), S135 (= S142), N145 (≠ G153), Y148 (= Y156), K152 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), R15 (= R14), I17 (= I16), D36 (≠ A35), L37 (≠ R36), R38 (≠ A37), V55 (= V54), D56 (= D56), L57 (= L57), N83 (= N85), A84 (= A86), A85 (≠ G87), I86 (≠ V88), V133 (≠ I140), S135 (= S142), Y148 (= Y156), K152 (= K160), P178 (= P186), G179 (= G187), I181 (= I189), T183 (= T191), A185 (≠ M193), V186 (≠ I194)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
31% identity, 98% coverage: 5:245/245 of query aligns to 2:245/245 of 4k6fB
- active site: G12 (= G15), N102 (= N102), S138 (= S142), Y151 (= Y156), K155 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), Y32 (≠ A35), S33 (≠ R36), N36 (≠ E42), V58 (vs. gap), D59 (= D56), V60 (≠ L57), A87 (= A86), G88 (= G87), I89 (≠ V88)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 99% coverage: 3:244/245 of query aligns to 4:243/244 of P0AEK2
- GASR 12:15 (= GASR 11:14) binding
- T37 (≠ R36) binding
- NV 59:60 (≠ DL 56:57) binding
- N86 (= N85) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSTSK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (= I189) binding
- E233 (≠ T234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 3:242/243 of 7emgB
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
32% identity, 99% coverage: 3:244/245 of query aligns to 3:242/243 of 1q7bA
- active site: G15 (= G15), E101 (≠ G107), S137 (= S142), Q147 (≠ S154), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ T234), T233 (≠ E235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), S13 (= S13), R14 (= R14), T36 (≠ R36), N58 (≠ D56), V59 (≠ L57), N85 (= N85), A86 (= A86), G87 (= G87), I88 (≠ V88), S137 (= S142), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), I183 (= I189)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
31% identity, 99% coverage: 3:244/245 of query aligns to 7:242/243 of 4i08A
- active site: G19 (= G15), N113 (= N115), S141 (= S142), Q151 (≠ S154), Y154 (= Y156), K158 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (= S13), R18 (= R14), I20 (= I16), T40 (≠ R36), N62 (≠ D56), V63 (≠ L57), N89 (= N85), A90 (= A86), G140 (≠ T141), S141 (= S142), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), T189 (= T191)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
31% identity, 99% coverage: 3:244/245 of query aligns to 3:242/243 of 1q7cA
- active site: G15 (= G15), S137 (= S142), Q147 (≠ S154), F150 (≠ Y156), K154 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), S13 (= S13), R14 (= R14), A35 (= A35), T36 (≠ R36), L57 (≠ A55), N58 (≠ D56), V59 (≠ L57), G87 (= G87), I88 (≠ V88)
2zatA Crystal structure of a mammalian reductase (see paper)
33% identity, 98% coverage: 3:241/245 of query aligns to 4:246/251 of 2zatA
- active site: G16 (= G15), S142 (≠ I143), L152 (vs. gap), Y155 (= Y156), K159 (= K160), K200 (≠ S195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G11), T14 (≠ S13), D15 (≠ R14), G16 (= G15), I17 (= I16), S36 (≠ A35), R37 (= R36), K38 (= K41), N41 (≠ M44), H62 (≠ D59), N89 (= N85), A91 (≠ G87), V140 (≠ T141), S142 (≠ I143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), I188 (= I189), T190 (= T191), F192 (vs. gap), S193 (vs. gap)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
33% identity, 98% coverage: 3:241/245 of query aligns to 32:274/279 of Q8WNV7
- 37:61 (vs. 8:32, 48% identical) binding
- F177 (= F151) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (vs. gap) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y156) active site, Proton acceptor
- K187 (= K160) binding
- N196 (≠ E169) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
Query Sequence
>WP_011384008.1 NCBI__GCF_000009985.1:WP_011384008.1
MSEVKTVVVTGASRGIGHAIARRFLAEGWRVITCARADVPKECMIDRNWACHIVADLADP
ASAQDFVAQANAWLGAEPLHALVNNAGVSPKTPYKERLGVLNGPIDGWKDVFELNFFAPL
RLARGFASALHRGKGAIVNITSIAGHYVHPFAGSAYSTSKAALSGLTREMAAEMAQLGVR
VNAVAPGEIRTEMISAEYEALVPRIPLERMGTPEDVAGTVFRLCGSDFDYVTGTEVFVTG
GQHLY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory