SitesBLAST
Comparing WP_011384075.1 NCBI__GCF_000009985.1:WP_011384075.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3o0hB Crystal structure of glutathione reductase from bartonella henselae
49% identity, 97% coverage: 3:445/455 of query aligns to 1:445/459 of 3o0hB
- active site: S13 (= S15), I37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), D74 (≠ G76), P75 (≠ A77), Y177 (= Y177), E181 (= E181), I314 (= I314), A433 (≠ G433), H435 (= H435), E440 (= E440)
- binding flavin-adenine dinucleotide: I9 (≠ L11), G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), A32 (≠ V34), E33 (= E35), E34 (≠ S36), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (≠ K114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y177 (= Y177), R262 (= R262), N265 (= N265), G301 (= G301), D302 (= D302), Q308 (≠ N308), L309 (= L309), T310 (= T310)
Sites not aligning to the query:
4dnaA Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
49% identity, 99% coverage: 3:453/455 of query aligns to 1:457/461 of 4dnaA
- active site: Y37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y178 (= Y177), E182 (= E181), A435 (≠ G433), H437 (= H435), E442 (= E440)
- binding flavin-adenine dinucleotide: I9 (≠ L11), G10 (= G12), G11 (≠ A13), G12 (= G14), G14 (= G16), E33 (= E35), E34 (≠ S36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (≠ K114), A113 (≠ G115), V139 (≠ T139), G140 (= G140), Y178 (= Y177), R264 (= R262), G303 (= G301), D304 (= D302), Q310 (≠ N308), L311 (= L309), T312 (= T310)
Sites not aligning to the query:
5ebkA Trypanothione reductase in complex with 6-(sec-butoxy)-2-((3- chlorophenyl)thio)pyrimidin-4-amine (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/486 of 5ebkA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (= G433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), G161 (= G140), S178 (= S157), Y198 (= Y177), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ N308), L334 (= L309), T335 (= T310), A338 (= A313)
- binding 6-sec-Butoxy-2-[(3-chlorophenyl)sulfanyl]-4-pyrimidinamine: C52 (= C43), V53 (= V44), Y110 (= Y99), Y221 (≠ L197), R222 (= R198), R222 (= R198), D224 (= D200), R228 (= R204), N252 (≠ T228), N254 (≠ Q230), I285 (≠ T260), H461 (= H435), E466 (= E440)
Sites not aligning to the query:
6i7nB Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/488 of 6i7nB
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G15 (= G16), D35 (≠ E35), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), G161 (= G140), Y198 (= Y177), R287 (= R262), G326 (= G301), D327 (= D302), M333 (≠ N308), L334 (= L309), T335 (= T310)
- binding ~{N}-(4-azanylbutyl)-~{N}-(2-azanyl-2-oxidanylidene-ethyl)-7-(3-azanyl-3-oxidanylidene-propyl)-4-(dimethylamino)-2-(2-naphthalen-2-ylethylamino)pyrrolo[2,3-d]pyrimidine-6-carboxamide: L17 (≠ V18), E18 (≠ R19), Y110 (= Y99)
Sites not aligning to the query:
6er5A X-ray structure of trypanothione reductase from leishmania infantum in complex with 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3- oxopropyl)amino)benzoate (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/488 of 6er5A
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), H461 (= H435), E466 (= E440)
- binding 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3-oxopropyl)amino)benzoate: Y221 (≠ L197), R222 (= R198), R228 (= R204), I285 (≠ T260)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), V34 (= V34), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), T160 (= T139), Y198 (= Y177), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ N308), L334 (= L309), T335 (= T310)
Sites not aligning to the query:
4apnA Structure of tr from leishmania infantum in complex with a diarylpirrole-based inhibitor (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/488 of 4apnA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (= G433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), A46 (≠ S37), G50 (= G41), T51 (= T42), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), T160 (= T139), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), L334 (= L309), T335 (= T310)
- binding 4-[[1-(4-ethylphenyl)-2-methyl-5-(4-methylsulfanylphenyl)pyrrol-3-yl]methyl]thiomorpholine: L17 (≠ V18), E18 (≠ R19), S109 (≠ V98), Y110 (= Y99), M113 (≠ L102), F396 (= F371), T397 (≠ K372)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), E202 (= E181), Y221 (≠ L197), R222 (= R198), R228 (= R204), A284 (= A259), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ N308), A365 (= A340)
Sites not aligning to the query:
4adwA Crystal structure of leishmania infantum trypanothione reductase in complex with NADPH and trypanothione (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/488 of 4adwA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (= G433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), G15 (= G16), D35 (≠ E35), A46 (≠ S37), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), A159 (= A138), T160 (= T139), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), M333 (≠ N308), L334 (= L309), T335 (= T310), H461 (= H435), P462 (= P436)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: F396 (= F371), L399 (vs. gap), H461 (= H435), E466 (= E440)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), Y221 (≠ L197), R222 (= R198), R228 (= R204), I285 (≠ T260), G286 (= G261), R287 (= R262), A365 (= A340)
Sites not aligning to the query:
2yauA X-ray structure of the leishmania infantum tryopanothione reductase in complex with auranofin (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 5:472/488 of 2yauA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y177), E202 (= E181), G459 (= G433), H461 (= H435), E466 (= E440)
- binding gold ion: C52 (= C43), C57 (= C48), T335 (= T310)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), D35 (≠ E35), V36 (vs. gap), A46 (≠ S37), A47 (≠ R38), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), F126 (≠ K114), G127 (= G115), A159 (= A138), T160 (= T139), R287 (= R262), R290 (≠ N265), D327 (= D302), L334 (= L309), T335 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), I199 (= I178), E202 (= E181), Y221 (≠ L197), R222 (= R198), R228 (= R204), I285 (≠ T260), G286 (= G261), R287 (= R262), M333 (≠ N308), A365 (= A340)
- binding 2,3,4,6-tetra-O-acetyl-1-thio-beta-D-glucopyranose: F396 (= F371), L399 (vs. gap), H461 (= H435)
Sites not aligning to the query:
2x50A Crystal structure of trypanothione reductase from leishmania infantum in complex with NADPH and silver (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 4:471/485 of 2x50A
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y177), E201 (= E181), G458 (= G433), H460 (= H435), E465 (= E440)
- binding silver ion: C51 (= C43), C56 (= C48), T334 (= T310)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), V33 (= V34), D34 (≠ E35), A45 (≠ S37), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (= G115), T159 (= T139), R286 (= R262), R289 (≠ N265), G325 (= G301), D326 (= D302), L333 (= L309), T334 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G175), G196 (= G176), Y197 (= Y177), I198 (= I178), E201 (= E181), Y220 (≠ L197), R221 (= R198), R227 (= R204), A283 (= A259), I284 (≠ T260), G285 (= G261), R286 (= R262), M332 (≠ N308), A364 (= A340)
Sites not aligning to the query:
2w0hA X ray structure of leishmania infantum trypanothione reductase in complex with antimony and NADPH (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 4:471/485 of 2w0hA
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y177), E201 (= E181), G458 (= G433), H460 (= H435), E465 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), V33 (= V34), D34 (≠ E35), A45 (≠ S37), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (= G115), T159 (= T139), R286 (= R262), R289 (≠ N265), G325 (= G301), D326 (= D302), L333 (= L309), T334 (= T310)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G175), G196 (= G176), Y197 (= Y177), I198 (= I178), E201 (= E181), Y220 (≠ L197), R221 (= R198), R227 (= R204), N253 (≠ Q230), A283 (= A259), I284 (≠ T260), G285 (= G261), R286 (= R262), M332 (≠ N308), A364 (= A340)
- binding antimony (iii) ion: C51 (= C43), C56 (= C48), T334 (= T310)
Sites not aligning to the query:
6t98A Trypanothione reductase from leishmania infantum in complex with 9a (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 6:473/489 of 6t98A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (= V34), D36 (≠ E35), A47 (≠ S37), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), Y199 (= Y177), I200 (= I178), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ N308), L335 (= L309), T336 (= T310)
- binding 4-[3-methyl-1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-3-ium-4-yl]butan-1-amine: W22 (≠ R22), S106 (≠ R94), S110 (≠ V98), M114 (≠ L102), D117 (≠ E105)
Sites not aligning to the query:
6t97A Trypanothione reductase from leismania infantum in complex with trl190
44% identity, 97% coverage: 6:446/455 of query aligns to 6:473/489 of 6t97A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (= V34), D36 (≠ E35), A47 (≠ S37), A48 (≠ R38), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), G162 (= G140), Y199 (= Y177), I200 (= I178), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ N308), L335 (= L309), T336 (= T310)
- binding 4-[1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-4-yl]butan-1-amine: E19 (≠ R19), W22 (≠ R22), S106 (≠ R94), S110 (≠ V98), Y111 (= Y99), M114 (≠ L102), D117 (≠ E105)
Sites not aligning to the query:
6t95A Trypanothione reductase from leismania infantum in complex with 4a (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 6:473/489 of 6t95A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), V37 (vs. gap), A47 (≠ S37), A48 (≠ R38), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), T161 (= T139), G162 (= G140), Y199 (= Y177), R288 (= R262), R291 (≠ N265), G327 (= G301), D328 (= D302), M334 (≠ N308), L335 (= L309), T336 (= T310)
- binding 1-[2-[5-[4-(4-azanylbutyl)-3-methyl-1,2,3-triazol-3-ium-1-yl]-2-[4-(2-phenylethyl)-1,3-thiazol-2-yl]phenoxy]ethyl]imidazolidin-2-one: E19 (≠ R19), W22 (≠ R22), S106 (≠ R94), I107 (≠ L95), S110 (≠ V98), Y111 (= Y99), M114 (≠ L102), D117 (≠ E105)
Sites not aligning to the query:
6i7nA Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
44% identity, 97% coverage: 6:446/455 of query aligns to 6:473/490 of 6i7nA
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y177), E203 (= E181), H462 (= H435), E467 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), A47 (≠ S37), A48 (≠ R38), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (= G115), A160 (= A138), T161 (= T139), G162 (= G140), R288 (= R262), D328 (= D302), L335 (= L309), T336 (= T310), A339 (= A313)
Sites not aligning to the query:
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
44% identity, 97% coverage: 6:447/455 of query aligns to 5:449/463 of D0VWY5
- SG 14:15 (= SG 15:16) binding
- E34 (= E35) binding
- T41 (= T42) binding
- C42 (= C43) modified: Disulfide link with 47, Redox-active
- C47 (= C48) modified: Disulfide link with 42, Redox-active
- K50 (= K51) binding ; binding
- HA 113:114 (≠ KG 114:115) binding
- 174:180 (vs. 175:181, 57% identical) binding
- LE 197:198 (≠ RG 198:199) binding
- V230 (= V231) binding
- G261 (= G261) binding
- D302 (= D302) binding
- Q308 (≠ N308) binding
- QLT 308:310 (≠ NLT 308:310) binding
- V341 (≠ A340) binding
- H437 (= H435) active site, Proton acceptor; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 binding
- 2:463 modified: mature protein, Glutathione amide reductase
- 3 binding
- 4 binding
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
44% identity, 97% coverage: 6:447/455 of query aligns to 4:445/451 of 2rabA
- active site: S13 (= S15), L37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y173 (= Y177), E177 (= E181), I310 (= I314), A431 (≠ G433), H433 (= H435), E438 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), I32 (≠ V34), E33 (= E35), S34 (= S36), T40 (= T42), G45 (= G47), C46 (= C48), K49 (= K51), H110 (≠ K114), A111 (≠ G115), T135 (= T139), G136 (= G140), R258 (= R262), G297 (= G301), D298 (= D302), Q304 (≠ N308), L305 (= L309), T306 (= T310)
- binding nicotinamide-adenine-dinucleotide: K49 (= K51), I169 (≠ V173), G172 (= G176), Y173 (= Y177), I174 (= I178), E177 (= E181), A193 (≠ L197), L194 (≠ R198), E195 (≠ G199), V227 (= V231), V256 (≠ T260), G257 (= G261), Q304 (≠ N308), V337 (≠ A340)
2r9zB Glutathione amide reductase from chromatium gracile (see paper)
44% identity, 97% coverage: 6:447/455 of query aligns to 4:447/453 of 2r9zB
- active site: S13 (= S15), L37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), G74 (= G76), Y174 (= Y177), E178 (= E181), I312 (= I314), A433 (≠ G433), H435 (= H435), E440 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), G14 (= G16), I32 (≠ V34), E33 (= E35), S34 (= S36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), H111 (≠ K114), A112 (≠ G115), T136 (= T139), G137 (= G140), I175 (= I178), R260 (= R262), G299 (= G301), D300 (= D302), Q306 (≠ N308), L307 (= L309), T308 (= T310)
1feaA Unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution
43% identity, 97% coverage: 6:446/455 of query aligns to 4:471/487 of 1feaA
- active site: S13 (= S15), L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), R84 (vs. gap), E85 (= E75), Y197 (= Y177), E201 (= E181), I338 (= I314), G458 (= G433), H460 (= H435), E465 (= E440)
- binding flavin-adenine dinucleotide: I9 (≠ L11), G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), I33 (≠ V34), D34 (≠ E35), L35 (≠ S36), G49 (= G41), T50 (= T42), C51 (= C43), V54 (≠ R46), G55 (= G47), C56 (= C48), K59 (= K51), F125 (≠ K114), T159 (= T139), G160 (= G140), Y197 (= Y177), I198 (= I178), R286 (= R262), R289 (≠ N265), G325 (= G301), D326 (= D302), M332 (≠ N308), L333 (= L309), T334 (= T310), A337 (= A313)
Sites not aligning to the query:
1typA Substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution (see paper)
43% identity, 97% coverage: 6:446/455 of query aligns to 5:472/487 of 1typA
- active site: S14 (= S15), L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), R85 (vs. gap), E86 (= E75), Y198 (= Y177), E202 (= E181), I339 (= I314), G459 (= G433), H461 (= H435), E466 (= E440)
- binding flavin-adenine dinucleotide: I10 (≠ L11), G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), A46 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (= G115), T160 (= T139), G161 (= G140), Y198 (= Y177), I199 (= I178), R287 (= R262), R290 (≠ N265), G326 (= G301), D327 (= D302), L334 (= L309), T335 (= T310)
- binding glutathione: S14 (= S15), Y110 (= Y99), I339 (= I314), F396 (= F371), H461 (= H435), P462 (= P436), T463 (= T437), S470 (≠ T444)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G196 (= G175), G197 (= G176), Y198 (= Y177), Y221 (≠ L197), R222 (= R198), R228 (= R204), I285 (≠ T260), M333 (≠ N308), C364 (≠ S339)
- binding spermidine: L17 (≠ V18), E18 (≠ R19), W21 (≠ R22), M113 (≠ L102)
Sites not aligning to the query:
P39040 Trypanothione reductase; TR; N(1),N(8)-bis(glutathionyl)spermidine reductase; EC 1.8.1.12 from Crithidia fasciculata (see paper)
43% identity, 97% coverage: 6:446/455 of query aligns to 5:472/491 of P39040
- C52 (= C43) modified: Disulfide link with 57, Redox-active
- C57 (= C48) modified: Disulfide link with 52, Redox-active
Query Sequence
>WP_011384075.1 NCBI__GCF_000009985.1:WP_011384075.1
MAAYDYDLITLGAGSGGVRASRMAAAAGRKVAVVESSRVGGTCVMRGCVPKKLLVYGAKF
AEDLTDSLGFGWSLEGADFDWARLVVAKNAELQRLEGVYLRLLKESGVTVVEGKGHLLDA
HTVQVGLRVLTAETILVATGGRPALPDVPGIEHAVTSNEALDLMQLPEKVVIVGGGYIAV
EFAGIFNALGVAVTLVLRGDTLLRGFDADIRATLAEEMTRKGVDLRTTTQVRAIRRHGHG
YGVELSDGQTLDADLVMYATGRVPNTEGLGLEKAGVVLNSKGAVMVDGLSRTSVRNIWAV
GDVTDRVNLTPVAIAEAMAFVRTAFSGQTTPMDYENIPSAVFSLPPVGTVGLTEAEATKR
YGAVDVYLSRFKPMRNILAGREERSMMKLVVDRATDRVLGVHMVGADAPEIVQGFAVALK
CGATKAQFDATVGIHPTAAEEFVTLRDKRAENGRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory